(data stored in ACNUC16935 zone)

EMBL: BN001307.PE47

BN001307.PE47        Location/Qualifiers
FT   CDS_pept        124831..125619
FT                   /locus_tag="ANIA_11160"
FT                   /old_locus_tag="AN11160.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007838"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007838"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007838"
FT                   /db_xref="GOA:C8VKY5"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY5"
FT                   /protein_id="CBF84456.1"
FT                   /translation="MANNTTPNLVVLVDADNAMPSTARLILAEVAKYGTVYVKRAYGDW
FT                   TSTSLKGWKKELLSQSIQPFQQFAYTNGKNSTDSAMIIDAMDLLYSNRFGGFCLVSSDS
FT                   DFTRLAARIRESGLTVYGFGEQKTPKPFVAACNKFIYTENLSFHGELVPHPDRVIVPKN
FT                   HVPARHAHADGHLKTLLHTTIETASDDDGWAELSNVGTLLTKKHPDFDSRTYGYNKLGD
FT                   LISALSLFDVVRQLPRKGKAGKIYVRDKRRGRKDSAASST"
     atggccaaca ataccacacc aaacctcgtt gtcctcgttg atgcggacaa tgccatgccg        60
     tcgacggcaa ggctcatact tgcggaagtc gcaaaatatg ggacagttta tgtgaaacgg       120
     gcctatggtg actggactag cacctctcta aagggctgga aaaaagaact ccttagtcag       180
     tctatccagc cattccagca gttcgcatac accaacggca aaaattcgac cgactccgct       240
     atgatcatcg acgcgatgga ccttctatat tcgaaccgtt tcggcggttt ctgcctcgtc       300
     tctagcgaca gtgacttcac tcggctggct gctcgtattc gcgaatctgg tctaactgtg       360
     tacggctttg gggagcagaa gacacccaag cccttcgtcg ctgcctgcaa taaatttatc       420
     tatacggaaa acctttcgtt ccatggggaa cttgtaccgc atcctgatag ggttattgtg       480
     cccaaaaatc atgttccagc gcggcacgcc cacgcagatg gtcacttaaa aactctgctt       540
     catacgacaa tagagacggc ctctgacgat gatggatggg ctgagctctc taacgtcggc       600
     acgctactta caaaaaagca ccctgacttc gactcccgga cctacgggta taacaagctc       660
     ggcgacctaa tatctgcttt atctctgttt gatgttgttc gacaacttcc tcgaaagggt       720
     aaagcgggaa agatttacgt acgagataag cgtcgagggc gcaaggactc tgccgcttca       780
     tcaacatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page