(data stored in ACNUC16935 zone)

EMBL: BN001307.PE470

BN001307.PE470       Location/Qualifiers
FT   CDS_pept        join(1317958..1318071,1318373..1318621)
FT                   /locus_tag="ANIA_01617"
FT                   /old_locus_tag="AN1617.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008254"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008254"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008254"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW3"
FT                   /protein_id="CBF85230.1"
FT                   /translation="MTFGTANSGTYGHCKKDDAFGMLDAFYSKGGNFIDTAIGISDTPA
FT                   WVVSKANEYARQKGPRQFVVYQGMWNATMRDFERDIIPMCREEGMGLCPYGVLNQGRFQ
FT                   TEEGFRSVKNTTRGGI"
     atgaccttcg gcaccgcgaa tagtgggacg tacgggcact gcaaaaaaga cgacgcattc        60
     ggtatgctcg acgccttcta cagcaaaggc gggaacttca tcgatacggc catcggcata       120
     tcggataccc cagcctgggt tgtctccaag gcgaacgagt acgcgaggca gaaaggaccg       180
     cggcaattcg tggtgtacca ggggatgtgg aatgcgacga tgcgcgactt tgagcgcgat       240
     atcatcccca tgtgccgaga ggaaggaatg ggtctctgcc cttatggagt ccttaaccaa       300
     ggccgcttcc agacagaaga gggtttccgg agcgtgaaaa acacaacgag gggcggaatt       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page