(data stored in ACNUC16935 zone)

EMBL: BN001307.PE471

BN001307.PE471       Location/Qualifiers
FT   CDS_pept        complement(join(1320046..1320222,1320296..1320454,
FT                   1320520..1320576))
FT                   /locus_tag="ANIA_01618"
FT                   /old_locus_tag="AN1618.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008255"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008255"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008255"
FT                   /db_xref="GOA:Q5BCW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW2"
FT                   /protein_id="CBF85232.1"
FT                   /translation="MFSPLTLAILAICIAVSSSLTVGCYPEDYQIVQNDLFDGLYSLKN
FT                   DQISNLQPGTCERVVCNSNAAVYWCNDNEDRHAEVKSKQVGDAAWKIIHDCGISAHTLI
FT                   YAAGVVVYPTKIRVVVIKDDECLDQH"
     atgtttagtc ccttgactct ggccatcctg gcaatctgca tcgcagtgtc ttcctctctc        60
     accgtcggct gctacccgga agactaccag atcgtacaga atgacctctt cgacggcctc       120
     tattccctca aaaatgacca gatcagcaac cttcagcccg gtacctgcga gcgcgttgtc       180
     tgcaacagca atgccgccgt ttactggtgc aacgacaatg aagatagaca tgcggaggtc       240
     aaatccaagc aggtcgggga tgctgcgtgg aaaatcatcc atgattgtgg aataagcgcc       300
     cataccctta tctacgccgc tggcgtggtg gtttacccga ccaagattag agtagtggtg       360
     attaaggatg atgagtgttt ggaccaacac tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page