(data stored in ACNUC16935 zone)

EMBL: BN001307.PE472

BN001307.PE472       Location/Qualifiers
FT   CDS_pept        join(1322448..1322900,1322957..1323094,1323152..1323930,
FT                   1323984..1324119)
FT                   /locus_tag="ANIA_01619"
FT                   /old_locus_tag="AN1619.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008256"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008256"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008256"
FT                   /db_xref="GOA:Q5BCW1"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW1"
FT                   /protein_id="CBF85234.1"
FT                   /translation="MLAAQFARTPGRRVMTKLSSQNPILRPASFLINQHNSTRKRAMSS
FT                   QPSATRTRALVDWASALQFTDLPPAVIARTKDFFVDTLACAVAGREHIAVKSMLEYSKI
FT                   MGPADGKCELIGFPDVKTTPAFAALVNGGAAHVVEQDDLHNSSMMHPATIIYPTALAVA
FT                   QDVGATGRDFITACVVGYEFACRAGEYLGKAHYEKFHTTATTGVLGAAATTAYLLRLDS
FT                   DQFLSSIGTAGTQAAGLWQFLLDATHSKQVHTAQACAAGVFSAYTSASGLLGTSDILEG
FT                   ERGMGATLGNLTTTPEAIDRDLGRKWSVLESSFKWHASCRHTHPSADALIALMHDENVK
FT                   YTDIESVTAYTYKAALDVLGLSGEGKTVHQSKFSMGFVLAVAAKKGTAGLTDFTEEALK
FT                   DPELRELQGRVKMVLDEEIDAAFPEKWLGRVVVQTKDGRTLSRTVDVVKGDPGWTLTRE
FT                   EIESKALALAEYGRVKDLNAFKDAIQRIWRLEEQDKINRFSFS"
     atgctcgccg cgcaattcgc ccgaactcca ggccgccgag tcatgacaaa gctctcctcg        60
     caaaatccta ttcttcgccc tgcatccttc ctcatcaatc aacataacag cactcgaaaa       120
     cgtgccatgt cctcccagcc ttcagcaact cgcacgcgcg ccctggtaga ctgggcaagc       180
     gccttgcagt tcaccgacct accacccgcc gtcattgccc gcacaaaaga ctttttcgtg       240
     gatactttag cctgcgccgt cgcaggtcgc gagcacatcg ccgtaaaatc catgctcgag       300
     tactccaaga taatgggccc agccgatgga aagtgcgagc ttatcggctt tccggatgtc       360
     aagacaaccc cggcctttgc ggcgctggtg aacgggggcg cggcgcacgt tgttgagcag       420
     gatgatttac ataatagtag tatgatgcac ccggcgacga tcatctatcc caccgcacta       480
     gccgtagcgc aggatgtcgg cgccactggt agggacttca tcactgcctg tgtggtggga       540
     tacgaattcg cctgtcgggc aggtgagtac ctcggcaaag cccactacga gaaattccac       600
     acaacagcga caacaggcgt gctgggcgcc gctgcaacaa ccgcctacct cctccgtctg       660
     gacagcgatc aatttctctc ctccatcggc accgctggaa cccaagcagc cgggctctgg       720
     cagttcctcc ttgatgcaac gcattcaaaa caagtacata ccgcgcaagc ctgtgcggcc       780
     ggtgtattct ccgcctacac ttccgcgtcc ggacttctag ggacatccga tatcctcgag       840
     ggcgaaagag gaatgggcgc tacactgggg aatctaacca ccacccctga agcaatcgac       900
     agggatctcg gacggaaatg gtctgtgtta gagagcagct tcaaatggca cgcttcttgt       960
     cgccacacac atccgagcgc cgatgcactg attgcgctca tgcacgacga gaacgtcaaa      1020
     tataccgata tcgaatccgt cacagcatac acgtataaag cggcgctgga cgtgcttgga      1080
     cttagcgggg agggaaagac ggtgcaccag agtaaattca gtatgggttt cgtgttggca      1140
     gtcgcggcga agaaaggcac ggcgggattg actgatttta cggaggaggc gctgaaagat      1200
     cctgaacttc gggagctgca gggccgggtg aaaatggtac ttgacgagga gatcgacgct      1260
     gcgtttccgg agaaatggct ggggcgtgtt gtggtgcaga cgaaggacgg gaggacgttg      1320
     agtaggacag tggacgttgt gaagggggat cccgggtgga cgttgacaag ggaggagatc      1380
     gagtcaaagg ctttggcgct ggcggagtat ggacgtgtga aggatctgaa tgcgttcaag      1440
     gatgcgattc agagaatatg gagactcgag gagcaggata agataaaccg attctccttt      1500
     tcgtga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page