(data stored in ACNUC16935 zone)

EMBL: BN001307.PE48

BN001307.PE48        Location/Qualifiers
FT   CDS_pept        complement(join(126351..126393,126452..127103,
FT                   127161..127504,127568..127677,127736..128291,
FT                   128337..128554))
FT                   /locus_tag="ANIA_09015"
FT                   /old_locus_tag="AN9015.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007839"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007839"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007839"
FT                   /db_xref="GOA:Q5ARR5"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR5"
FT                   /protein_id="CBF84458.1"
FT                   /translation="MAWSASFRVCPICLALFLTLEKMIADNLQKALADRIARAKSRGFT
FT                   LEYQNEQEQQENVICRRELAPATFNKYEFSLKALTAARWRLSRNEPQNANFSKDDPDPS
FT                   PQLLKLFVEDYIVTREHTPTQKTACSILICFVSRWERETSRSMPEAVKEDVLNVRHPLF
FT                   LLLSFITDRSKHIRTALTTKYGLPTRPRERFLVTAKDIELLLRHLFVNDTHDYVHERAR
FT                   VQTGTGLSLFAGSGARAGAIVESSSYRGTNECLYYRHLSFHLKWSRKGDGLKRWVTIDP
FT                   EFLKGWRYRDDVTLPKNWLREHPVLGMNFVFWVIVHGVADGAFKGLPTVANVLAAKPPE
FT                   GRESWTLEWSDKAKDLPFFRMVTPEGPHATRALTFSSLHHNFTSLAQRDCFKDQLRVHG
FT                   IRGGVANLIDPKASEATRGQALDHQNHETYLKYQSVLKALDIQSLFYDLEPEYECRDME
FT                   QSMAHHRDTNVPQKLDAAAIAEFEAQDEIVKINRRIAVLTAEIAGNPRGHEDLVSERAR
FT                   LYTKKAKRRRAWKAEFIRRWWDSSYDEYISGNNFAERDTTPLFGIYKKYLPERARLSEN
FT                   LFRETPLDSDIGRQCLEDMVALCKSTERVVYYPDMSPVSGCCPTCSKPMSGGRQSTFYN
FT                   VEEAL"
     atggcatgga gcgcttcttt cagggtctgt cctatctgcc tcgctctctt cttgactctc        60
     gagaaaatga tcgctgataa tcttcagaaa gcccttgcgg atcgcattgc acgtgctaag       120
     tcacgtggat tcacactcga gtatcaaaac gaacaggaac aacaggaaaa cgtcatatgc       180
     cgtcgagaac tagcacctgc gacattcaat aaatacgaat tttccttaaa ggcactaaca       240
     gctgctagat ggagactctc tcggaacgag ccacagaatg ccaacttttc caaggatgac       300
     cctgatccaa gtccacagct cctgaaactt tttgtggagg attatattgt gacaagggag       360
     catactccta ctcagaaaac tgcctgttcc atcttgatat gtttcgtgtc gagatgggaa       420
     cgagagacct ctcgatcaat gcctgaagca gtcaaggaag atgttctcaa cgtaaggcat       480
     cccttgtttc tgcttttgtc tttcatcact gatagaagca agcatatacg aacggcgttg       540
     acgactaaat acgggctacc tacgaggcca cgggaacggt tcctagtcac agcaaaagac       600
     atagaactcc ttctccgtca tctctttgtc aacgataccc acgactatgt acatgagaga       660
     gcgcgagtgc aaactggaac tggcctatcc ttgtttgctg ggtcaggagc aagggcgggt       720
     gccatagttg agtcaagctc ctatcgtggg acgaacgaat gtctctacta caggcatctt       780
     tcctttcatc ttaaatggag ccgaaagggc gatggcttaa aacgttgggt gacaattgat       840
     cccgaatttc taaaaggatg gcgctatcgt gacgacgtga ctctacccaa aaactggcta       900
     agggagcacc ctgttcttgg gatgaatttt gtgttctggg taatcgtgca tggcgttgcc       960
     gatggtgctt ttaaaggact tcctactgtg gctaatgttc ttgccgctaa gccccctgag      1020
     ggaagagaat catggaccct tgaatggagt gacaaggcaa aggaccttcc tttttttagg      1080
     atggtcactc ctgaaggacc gcacgccact cgagcgctga cgttctcttc tttgcaccac      1140
     aacttcacga gccttgctca gcgggattgc tttaaagacc agctacgtgt gcatgggatc      1200
     aggggtggtg ttgcgaatct aattgacccc aaggcgtcag aggcaactcg cggccaagcg      1260
     cttgatcatc aaaaccatga gacctatctc aaataccagt ctgttctcaa ggctcttgac      1320
     atacaaagtc tgttctatga tctagagcct gaatacgagt gccgggacat ggaacaaagt      1380
     atggctcacc acagagatac gaatgttcct caaaagcttg atgcagctgc catcgcagag      1440
     ttcgaggcgc aagatgaaat tgtgaaaata aaccggagaa ttgccgtttt gacggctgag      1500
     attgcgggga acccacgagg acatgaggac cttgtttccg aaagggcccg tctatatacc      1560
     aagaaggcga agcgtcgacg ggcatggaag gcggagttta ttaggcgatg gtgggattca      1620
     tcatacgatg aatacatctc gggaaataac ttcgctgagc gcgacacaac acctcttttc      1680
     ggcatttaca aaaagtacct gccggagcgc gcccgcctaa gtgagaacct tttcagagaa      1740
     acgccactgg acagcgacat cggtaggcag tgcctggaag acatggtcgc actttgcaaa      1800
     tctacagagc gcgtcgtcta ttaccctgac atgtctccag tgtctggttg ttgccccaca      1860
     tgttccaaac ctatgtctgg gggaaggcaa agcacatttt acaatgtcga agaagctctt      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page