(data stored in ACNUC16935 zone)

EMBL: BN001307.PE49

BN001307.PE49        Location/Qualifiers
FT   CDS_pept        complement(join(129134..129209,129265..129341,
FT                   129409..129764,129992..130226,130280..130420,
FT                   130475..130561))
FT                   /locus_tag="ANIA_09014"
FT                   /old_locus_tag="AN9014.4"
FT                   /product="FMN-dependent dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G02300)"
FT                   /note="transcript_id=CADANIAT00007840"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007840"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007840"
FT                   /db_xref="GOA:Q5ARR6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR6"
FT                   /protein_id="CBF84460.1"
FT                   /translation="MAHRGESFHKDVSCIADLKALGSSRLPATSDYYNEGAMDLITLRD
FT                   NEAAFDRYKILPRVLINVAKVDTSTEILGTKVSLPFGFSPAASQKLAHPDGELATSRAA
FT                   ANFGICMGLSSYSNYSLEDVAAQGMGNPYVMQMCVLRDRSITLQLLQRAENAPNRPSLP
FT                   DPSLDWASTIPWLREHTSMQIWLKGVCSPADVELAIHYGVDGIVISNHGGRQLDGVPAT
FT                   LDSLRLCAEVAKGRIPLAIDGGIRRGSDIFKALALGARYCFMGRIPIWGLAYNGQEGVE
FT                   LAIKILRQELRVTMALAGCQTISEIRESHLSVLQPDGRLSKL"
     atggcgcacc gaggagagag cttccacaag gatgtatcct gcattgccga tttgaaggcc        60
     ttgggaagca gtaggcttcc tgccacgtca gactactaca acgaaggcgc tatggacctg       120
     atcacattac gcgacaacga ggcggcattt gaccggtata agatccttcc ccgggtcctg       180
     atcaacgtcg ccaaagtgga cacgagcacc gagatactgg ggacgaaggt gtctctcccc       240
     ttcggattca gcccagcggc ctcgcaaaaa ctcgcgcatc cagacggcga actcgccaca       300
     tcacgcgccg cagccaactt tggcatctgc atggggctgt cctcatactc gaactattcc       360
     ctcgaggatg tagcggccca ggggatgggt aacccgtatg tcatgcagat gtgcgtgctg       420
     cgtgatcgat ctataacgct gcagttgttg cagcgggcgg aaaacgcccc taaccgaccg       480
     tccttgccag atccaagtct tgactgggcc agtacaatcc cgtggctccg cgaacacaca       540
     tcaatgcaga tatggctcaa gggggtgtgc tctcccgcag atgtcgaact cgccattcac       600
     tacggcgttg acggcatcgt catctccaac cacggcgggc gccagctcga tggcgtccct       660
     gcaacactcg actcgctgcg gctgtgcgcc gaagtcgcca aggggcgtat accgctggct       720
     atcgatggag gcatccggcg gggttccgat atcttcaagg ccctggcgct gggtgcgaga       780
     tactgcttca tggggaggat tcccatctgg ggacttgctt acaacgggca ggaaggagtc       840
     gaacttgcta taaagattct gaggcaggag ttgagggtga cgatggcact ggctgggtgc       900
     cagaccatat ctgaaatccg ggaaagccat ctgtcggttt tgcagccaga tgggcgactt       960
     tccaagttgt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page