(data stored in ACNUC16935 zone)

EMBL: BN001307.PE5

BN001307.PE5         Location/Qualifiers
FT   CDS_pept        join(13794..13962,14199..14275,14656..14821,14946..15722,
FT                   15829..15932,15994..16038,16078..16163,16193..16215,
FT                   16712..16806,17230..17271,17328..17333,17420..17437)
FT                   /locus_tag="ANIA_09056"
FT                   /old_locus_tag="AN9056.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007797"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007797"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007797"
FT                   /db_xref="GOA:Q5ARM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM4"
FT                   /protein_id="CBF84379.1"
FT                   /translation="MGLFSRDRGEPWDLGIRGLSLAVSGRTPTTIFSSGLTIYPSQCLP
FT                   QDSMLDCYRDRVAAAAMALQRSRMNPRAAIFLNDSHKAVSVQIQPSAAMSSPIPVGVFF
FT                   NIFALRRIRRRETTSSSTDLDSQEIPNVCYETCNGAFLEAAGRGKMAAICADGSTFSDL
FT                   VDQCRQCIELFVNSPSSNSTASASSGSTTAELNEFIAYCDEQGGGSGNSNVTLVKEIDS
FT                   LLASYSSLSSSQSQLQASLSSLGYTGDFPELTSATATGDVTASSTSMVGPTATAGGEDR
FT                   SFSNEGGTGTEDLPSSDTSDINIIAPAVIVPVFALLVGSVLAWALIRRRRKRQGTEEIG
FT                   AAGDSFDDKAQLHADEFRPELDGLAIAKKRLVNMDEDLAELPAREPIGAELDGLGRIPS
FT                   NLGMYNHDRLGALIQFFNITKKPKEFIGSWDNRIVNALNPSSMLTSQEQRDPSPGQLHR
FT                   IGASGNGELYSDSLAMRCSCTVVHKSVMNAQRGKGRRKLHLDLFNPTHETRQEMGWLDL
FT                   SFMQCRLSALRFKYSMIL"
     atgggcctgt ttagcagaga ccgaggggaa ccctgggatc ttggaattag ggggttgagt        60
     ctggctgttt ctggacgaac ccctacgact atttttagta gtggtttaac gatttaccca       120
     tcgcagtgtc tgccgcagga tagcatgttg gactgctata gggacagagt tgctgctgct       180
     gcgatggctc tacaacgatc acgcatgaac ccacgagcag ccatcttcct gaatgatagc       240
     cacaaagctg tatcagttca gatacagccg tcggccgcaa tgtcgtcccc gataccagtt       300
     ggagttttct ttaacatttt tgccctgcgc aggataagac gcagagaaac aacctcctcc       360
     agcacagact tggattcgca agagatcccc aatgtttgct atgaaacctg caatggcgcc       420
     ttcctcgagg cggctggaag aggcaagatg gccgcaatct gtgccgacgg ttccactttt       480
     tcagacctgg tcgatcaatg caggcaatgt atcgagctct tcgtcaactc gccttcctcg       540
     aactccaccg ccagcgcatc atctggcagc accactgctg aactcaatga gttcatcgcg       600
     tattgcgacg aacagggcgg aggcagcggt aacagcaatg tcacactcgt gaaggagatt       660
     gactcgctgc ttgcctcgta ctcgtccctc tcgtctagtc agtctcagtt gcaggcttct       720
     ttgtcgtcgt tggggtatac gggtgatttt ccagagttga ctagtgccac cgcgacaggt       780
     gatgtgactg caagtagtac gagcatggtt gggccgacag ccactgcagg gggcgaggat       840
     cggagttttt ctaacgaggg tgggacaggc acagaagatc taccctcctc cgacacatcg       900
     gatatcaata ttattgctcc tgctgtgatc gtaccggttt ttgcactcct tgtaggatcc       960
     gtgctagcgt gggctttaat acgtcggcgg agaaagagac aaggcacgga agagatcggt      1020
     gcggcaggcg atagctttga tgataaggct cagcttcatg ccgatgaatt caggccggag      1080
     cttgatggct tggctattgc aaagaaaaga ttggtgaaca tggatgaaga tctagcggaa      1140
     ctgcctgcaa gggaacctat tggggctgag ttggatgggc tgggaaggat ccccagcaac      1200
     ctgggaatgt acaaccatga ccggctgggc gctttaattc agttcttcaa cataaccaaa      1260
     aagcccaagg aatttatagg ttcatgggat aaccgcattg ttaatgctct caatccgtca      1320
     agcatgctca ccagccagga gcagcgagat ccgtcgcctg gacaattaca cagaattggt      1380
     gctagtggta atggcgaatt atactctgac tccttggcga tgcgatgctc atgcacagtt      1440
     gtccataaaa gtgttatgaa tgctcaaagg ggaaagggta gaaggaagct gcatctagac      1500
     ttgttcaacc caacccacga aacccgccaa gaaatgggtt ggttagattt atcctttatg      1560
     cagtgtagat tatctgcatt gaggtttaag tatagcatga tcttgtaa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page