(data stored in ACNUC16935 zone)

EMBL: BN001307.PE51

BN001307.PE51        Location/Qualifiers
FT   CDS_pept        complement(133560..134456)
FT                   /locus_tag="ANIA_09012"
FT                   /old_locus_tag="AN9012.4"
FT                   /product="dihydrodipicolinate synthetase family protein
FT                   (AFU_orthologue; AFUA_8G02270)"
FT                   /note="transcript_id=CADANIAT00007842"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007842"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007842"
FT                   /db_xref="GOA:Q5ARR8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR8"
FT                   /protein_id="CBF84463.1"
FT                   /translation="MSDLNLNGILVALVTPFTDDKTAIDEARLELHIKHMLDAGIHGLV
FT                   PGGSTGEFTTLSLSERKQLTELCVRFAGGRVPVVAGTGATSTSEAVELAVHAKEVGAAA
FT                   VMVVPPFYDPVNLQQLTELLAEIHEKSTLPIMYYNIPSASGLKLSPSEIAGLSRVGVRW
FT                   LKDTSGDAPAFTELVFGLSDQITALNGWDTLTFYGLAAGCPGGVWGAANIIPELAVELY
FT                   EAVSIKKDLDKGKELWSKAWPICKFLESHNYAAAVKTGVELTGQATGGLRKPFALLGPE
FT                   LQEELKGLLKNAGVATV"
     atgtccgacc tcaatctaaa cggtatcctt gtcgccctcg taaccccctt cactgacgac        60
     aaaaccgcca tcgacgaagc cagactagaa ttacatatca agcacatgct cgacgccggg       120
     atccacggcc tcgtccccgg tggctccacc ggcgaattca cgaccctctc gctctccgaa       180
     cgcaagcagc tcaccgaact ctgcgtccgg ttcgctggcg gccgcgtccc tgtggtcgca       240
     gggacaggcg caacctcgac ttctgaagca gtcgagctcg ccgtgcacgc gaaagaggtc       300
     ggcgcggcgg cggtgatggt agtgccgccg ttctatgacc ccgttaacct gcagcaactc       360
     actgagttgc ttgccgagat tcatgagaag agcactctac ctatcatgta ctataatatt       420
     ccctccgcat cggggcttaa gttgtcgccc tctgagattg ccggtctgag tagggtcggg       480
     gtcaggtggc tcaaagatac gtctggtgat gcgccagcat tcacagagct ggtcttcgga       540
     ctctctgacc agatcactgc gctgaacggc tgggatacgc ttacattcta tgggctcgcc       600
     gctggttgtc cgggtggtgt gtggggtgct gcgaatatca tcccggagct ggcggtggaa       660
     ttgtacgagg cagtttctat aaagaaggat ctagataaag ggaaggagct ctggagcaag       720
     gcctggccga tctgcaagtt tctcgagtcg cataactatg ccgctgcagt gaagacaggt       780
     gttgagctga cggggcaggc gactggggga ctccgcaaac cgtttgcgct gctgggtcca       840
     gagttgcagg aggagttgaa ggggttgcta aagaatgctg gcgtagctac ggtctag          897
//

If you have problems or comments...

PBIL Back to PBIL home page