(data stored in ACNUC16935 zone)

EMBL: BN001307.PE52

BN001307.PE52        Location/Qualifiers
FT   CDS_pept        join(135753..136206,136268..137263,137345..137748)
FT                   /locus_tag="ANIA_09011"
FT                   /old_locus_tag="AN9011.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007843"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007843"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007843"
FT                   /db_xref="GOA:Q5ARR9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR9"
FT                   /protein_id="CBF84465.1"
FT                   /translation="MTQSQVHESGDSPVASIEEFTTTPFDFIVCGGGTAGLAIAARLSE
FT                   ISNVNVGIVEAGKYRIGDPLIETPATFMQMFEDPEYDWCLFTAPQEANNGKVHHIPRGK
FT                   VLGGSSAINYLMYVRGSLQDYDDWAALVGDEGWSAANMKAYMRKHQAQPVNPESKAAAS
FT                   PIAPEHHGTTGPIRTSFNESNLPIETDFVKACAETANLPNMPIDAWSGDHIGFYHTLGA
FT                   VARTGPNRGKRSYAGIEYYEANRLRPNLKLLCEARVNKVILNGTRATGVSITFRGQEYT
FT                   VSASREVIVSGGTIQSPQILELSGIGDPEVLAASGVQCLVENRAVGANVQDHSVSLISW
FT                   QMQPGVVTSDTLGQVPEAAAAALHQYAESRTGPLSSIGSTQGFIPVKSILSDAELAEIV
FT                   QSIRDIKPSSAFHEKQLQQVIAHLESETSANLQVVFLPCSVHENGVEHQRGLFTPPPVG
FT                   EPVCVSAAPCLQYPVSRGSIHINSNDPSVPPTIQPNYISHSADVALLAAFLSWIDRVGH
FT                   AAPFASSVSRRILPKSSLDLQDSEQAKRAIHDTVIGEYHICGSVAMGDALDSRLRVKGV
FT                   EGLRVVDASVFPNNVSGNIMSSVYAVAEKGADLVKEDHGLL"
     atgacccagt cccaagtcca cgagagcggc gactctcccg tcgcctcgat cgaggagttt        60
     accaccactc ccttcgactt tatcgtctgc ggcggtggaa cagctgggct ggccatcgcc       120
     gcccgtctga gcgagatttc gaatgtcaat gtcgggattg tagaggcagg aaaataccgc       180
     atcggcgacc cgctcatcga gacgcctgcg acgttcatgc agatgtttga ggacccagag       240
     tacgattggt gtctgtttac agcgccacag gaagcgaaca acggcaaggt ccatcatata       300
     ccgcgcggaa aagtcctcgg cggatccagt gcaatcaatt acttgatgta tgtacgggga       360
     tcgctgcagg actacgatga ctgggccgcg cttgtcggtg atgaggggtg gtcagctgca       420
     aacatgaagg cgtatatgcg caaacatcag gctcaaccgg tcaatccaga gtccaaggcg       480
     gcagcatctc ccatcgcccc tgagcaccac ggtacgaccg gccccattcg aacgagcttc       540
     aatgagtcaa acctgcccat cgaaaccgac tttgtcaagg cttgcgccga gacggcgaac       600
     ttgccaaaca tgcctattga cgcttggagc ggagaccata tcgggttcta ccataccctg       660
     ggcgctgtcg cccgtacggg tccgaaccgc ggcaaacgaa gctacgccgg gatcgagtat       720
     tacgaagcga acaggttgcg gccaaatctc aaacttctct gcgaagcgcg tgttaacaaa       780
     gtcattctca acggcaccag ggctaccggt gtcagtataa cattccgagg tcaggagtac       840
     accgtctccg caagtcgcga ggtcatcgtt tctggcggga ccatccagtc ccctcagatt       900
     ctcgagctat ccggcattgg cgacccagaa gttctcgctg cctccggcgt ccagtgtctg       960
     gttgagaacc gcgctgtcgg tgctaacgta caggaccaca gtgtcagcct gataagctgg      1020
     cagatgcaac ccggtgtggt gaccagcgac acactgggcc aggtccctga agccgcagct      1080
     gcagcactgc atcaatacgc agaatcccgc acaggtccat tgagctcaat tgggagcaca      1140
     cagggtttca tccccgtcaa gagtatcctc tcagacgccg agctcgccga gatcgtgcag      1200
     agtatccgtg atatcaagcc gagtagtgcc ttccatgaaa agcagctgca gcaagtcatc      1260
     gctcatctag aaagcgagac ctcagcgaac ttgcaggttg tcttccttcc atgcagtgtc      1320
     catgagaatg gtgttgagca ccagcgtggc ctgttcacgc cgccgccagt aggagagccg      1380
     gtttgtgtct cggccgcgcc gtgtctgcag tacccggttt cacggggatc tatccatatc      1440
     aatagcaacg atccctcggt cccgcccact atccaaccaa actacatcag ccactccgca      1500
     gacgtcgcac tcctggctgc gttccttagt tggatagaca gagttggaca cgctgcacct      1560
     tttgcatcct cagtctcccg ccgcatcttg cccaaatcgt cgcttgacct gcaagattcc      1620
     gaacaggcga agcgtgccat ccacgacacc gtgatcggtg agtaccatat atgcggctcg      1680
     gtcgcgatgg gggatgcgct ggactccagg ttgcgagtta aaggagtaga gggtcttcgc      1740
     gttgtagatg caagcgtgtt tcccaacaat gtgtctggta atataatgag tagtgtctat      1800
     gcggttgcgg agaagggtgc ggatttggtg aaggaggatc acgggctgct ctag            1854
//

If you have problems or comments...

PBIL Back to PBIL home page