(data stored in ACNUC16935 zone)

EMBL: BN001307.PE54

BN001307.PE54        Location/Qualifiers
FT   CDS_pept        join(140489..140562,140686..141154)
FT                   /locus_tag="ANIA_09009"
FT                   /old_locus_tag="AN9009.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007845"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007845"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007845"
FT                   /db_xref="GOA:Q5ARS1"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS1"
FT                   /protein_id="CBF84469.1"
FT                   /translation="MATVHPNAEKLISLAEEFFAEVADLTPGRALEEYLNEHYGPGNKY
FT                   YDTFCSLILSGLRNNEGWVATDELDGPRYRRSRLCDPSERTRYFSITTVYMQSQDEYRG
FT                   QYHLHPYGEINCVVQVDRTAELKGMNGWQAAGWTSPAAGTHHYPEVRGGALVALFFLPA
FT                   GRISYKATPEMAQPPYV"
     atggcaacgg tccacccaaa tgctgagaaa ctcatatcgt tggcggagga gttctttgcc        60
     gaagtcgccg atctaactcc cggtcgcgcc cttgaggaat atctgaatga acactacggc       120
     cccggcaata aatactacga caccttctgc tcgctcatcc tcagcggtct tcgcaacaac       180
     gaaggctggg tcgccaccga cgagctagac ggccccagat acaggcgcag ccgactctgc       240
     gatcccagcg agcgtacgcg ctatttcagt attacgaccg tctacatgca gagtcaggac       300
     gagtatcgag ggcagtatca tctgcatccg tatggggaga tcaattgcgt ggtgcaggtc       360
     gatcgcacag ctgagttgaa ggggatgaat gggtggcagg cggccgggtg gacctcgccg       420
     gcggcaggaa cgcaccacta tcccgaagtg agaggaggtg cactcgttgc gctgttcttc       480
     ttgccggccg ggaggatctc gtataaggcg actcccgaga tggcgcagcc gccgtatgtg       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page