(data stored in ACNUC16935 zone)

EMBL: BN001307.PE57

BN001307.PE57        Location/Qualifiers
FT   CDS_pept        complement(join(151066..151248,151315..151647))
FT                   /locus_tag="ANIA_09006"
FT                   /old_locus_tag="AN9006.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007848"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007848"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007848"
FT                   /db_xref="GOA:Q5ARS4"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS4"
FT                   /protein_id="CBF84475.1"
FT                   /translation="MKVFNAILILYTLLPSLAIAQSPIDAALAQFQQLNDRIDSAQRSI
FT                   NAYNGGVLLALPVANSLYSAHTAATTARQSLTALDPLSPEDSQRALDAYNEVHPRLLAT
FT                   LAAGRDKAQVFRDAGVGYVAQGMISNLYNEKNRFEAALRDKIYPGYFQNDLAEAVDHAF
FT                   QGTLAQFY"
     atgaaggtct ttaatgccat cttgatcctt tatactctcc ttccctccct cgccatcgcg        60
     caatcaccca tagatgccgc tctcgctcag ttccagcaac taaacgaccg gatcgacagc       120
     gcgcagcggt ccatcaacgc ctacaacggc ggtgttttgc ttgctctccc cgttgcgaac       180
     agcctctaca gcgcacacac cgctgcaaca acagcgcgtc agtcccttac agcactagat       240
     cccctttctc cagaggatag ccagcgtgcg ctggacgcat acaacgaggt tcatccgcgg       300
     ttacttgcaa ctctcgcggc cggacgcgat aaggcacaag tcttcagaga cgcaggcgtt       360
     ggatacgttg cgcaaggaat gattagtaac ctttacaacg agaagaaccg gttcgaagct       420
     gcactcaggg acaagattta tccgggatac ttccagaatg atctggctga ggcggttgat       480
     catgcctttc agggtacttt ggcacagttc tactag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page