(data stored in ACNUC16935 zone)

EMBL: BN001307.PE6

BN001307.PE6         Location/Qualifiers
FT   CDS_pept        join(20646..20903,20993..21184)
FT                   /locus_tag="ANIA_09055"
FT                   /old_locus_tag="AN9055.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007798"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007798"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007798"
FT                   /db_xref="GOA:Q5ARM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM5"
FT                   /protein_id="CBF84381.1"
FT                   /translation="MQCCVKLVILISHADEIYENPTIFAEQRMYGRGSSVQHQTQTQTQ
FT                   TVAHELMFGKVVQLGVEYLFPGCGDKDPTLGKRDLFVRFQSSVYQPRKMVRYDVHESVR
FT                   IEDKTLETGVEYLIPSPTETGAGSCIGFLDGTELRSLLKAKNPIP"
     atgcagtgct gtgtgaagct ggttatcctg atttcgcacg cggatgagat ttacgagaat        60
     ccgacgatct ttgctgagca gcggatgtat gggcgcggct cgagtgtgca acaccaaaca       120
     cagacccaga ctcagactgt cgcccacgag ttgatgtttg gtaaagtagt ccagctcggt       180
     gtcgagtatc tcttccctgg ctgtggtgat aaagatccga cattggggaa gcgggatctg       240
     tttgttcgat tccagtcttc agtatatcaa ccgcgcaaga tggtacggta tgatgtacac       300
     gaaagcgttc gaattgaaga caagacgctc gaaaccggag ttgaatatct tattccgtca       360
     cccaccgaga ctggcgctgg ctcgtgtatc ggatttctcg acgggactga gcttcgaagc       420
     ctgctaaagg caaaaaaccc cattccatag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page