(data stored in ACNUC16935 zone)

EMBL: BN001307.PE60

BN001307.PE60        Location/Qualifiers
FT   CDS_pept        join(164400..168505,168547..168604)
FT                   /locus_tag="ANIA_09003"
FT                   /old_locus_tag="AN9003.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007851"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007851"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007851"
FT                   /db_xref="GOA:Q5ARS7"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS7"
FT                   /protein_id="CBF84480.1"
FT                   /translation="MDPLSITASVAGLATLAYQIIGYLGTVRSGGKDRLNLCREVTYLW
FT                   MSITSLLEQLSSDAIKDDKIPDSLRPLFDPDGIIKEIKIQLEDLEHTIKSRSTHGKIAQ
FT                   TLAWPFTQKDAEKMIDRIHRLKSTLQDGINQSTHALSQDIYRDGQGIKKVIDESRLKEL
FT                   IEWISPLNFITKQSMIWNEHHKGTCKWFLERDDFREWREGSNTRIFCPGIPGAGKTFLS
FT                   SIVYNELEALRVRDEGGLKGAAVVMLYCKWDDPLSQDIDNLLASVIKQFVQRYDVGTSD
FT                   MMELFTKHSKEGTRSSRAQLQSTLELLYSRFTKVFIILDGLDELRSEKEQLPLLMSLAP
FT                   NGSPYTVNLMVTSRPVPNIVRHFRHWPSLGGSIICDGCNAEGLAVQYHCADCEDYDLCQ
FT                   SCYKAGTRCGYKGHTYHLEFNARTIPIAAVEEDLTTYVHWRTSASETLQQFLEIKEGLM
FT                   DAILDTVVKNNEGMFLLAKFNMDTLESTLSIKQLMAALKTLPQELDGTYEDAMLRITEL
FT                   KASTRETVMRFLSWVVFAEQPLQEKAIEHALAVSDGDADIDDDNIIRARTLATKCAGLV
FT                   QLDESDCLRLVHYSAENYFRQHRDRWFPAGNVTIASSCLTYLQFDVFRSGACSGPSEDI
FT                   DFESRLSKYPFLRYASINWGKHLRVAADDHLSARALALITDAGCLATIAQALWYLEDQQ
FT                   QSNSWSSKNGSALHLATHFDLDILVKDLLSQGYDPNMRDINGVTPLALAVQRDLLDILI
FT                   TLTNAGASVNMPDNGGRSPLHWAIYHNLPDVVRFLLDHKDIDVNMPAARWSHYTPLMLA
FT                   SAYGFDDYVSMLLTKPKIDVNYASPEGATALILAARHGGTGAARLLLANQEIKINYADS
FT                   SGSTALTVAAENGYYDLVEALLDAGADTEVLQEGSNGTAIMRAIDDGRTSIVQLLVDRG
FT                   ANVHHKDVFDRGLLHSAAVNRRADILRILLKHDPTLDVNMQDVHGKTTLHDIARMGDLE
FT                   TVDVLLEAGGDPTIKDIHGRTPILVAHESHHPAILEMLRAARQRMKAEGQNYKLQRTPS
FT                   GTTVDSEDYGIKRADTGLSIHGTLPLWSLVVSKQFTELKERLPESSPEDINQVEPDMGQ
FT                   AALHWAVSDSDASIVKLLIDYGADINLRNRYGRTPLSLAVIDGLWDKARLLLEAGADPD
FT                   IEDQWGWPPLWMAGPRLGILLIENGAKLPPPPTFTGGGTDEGENIEKAAGKVDLENFLR
FT                   WAAQFGSETALRRLVQAGADVWSKDPSGKTPYMIAKEYGYDELANLLVQLAPMPQVGAD
FT                   GPRPKTDERAEKTATSGMPEDKSEDGTTKVKTDDIEKPKKEEDSVLPDKGMALDGLDST
FT                   TLVPASNVNKTKPGYSTLLLGSAHGRDGVGAIVMTIMHDGRRFD"
     atggacccgt tgagcatcac cgccagcgtc gctgggctcg caacgctcgc ctaccagata        60
     atcggctact taggcactgt ccgatcaggt ggaaaggacc ggctgaatct gtgtcgtgag       120
     gtgacatatc tctggatgtc gatcacctcg ctcctcgaac agctctcctc cgatgcgatc       180
     aaagacgaca aaatcccgga ctcgctccgc ccgctctttg accctgatgg gatcatcaag       240
     gagatcaaga tccagctcga ggatctggag cacacgatca aatcccgcag tacgcatggg       300
     aaaatcgcgc agaccctcgc gtggccgttt acgcaaaagg acgccgagaa gatgattgac       360
     cggatccatc gcctcaagtc gacgttgcag gatggaatca atcagtcgac gcatgcgctc       420
     tcgcaagata tctaccgcga tgggcagggt atcaagaagg ttattgatga gtcgaggttg       480
     aaagagctga tcgaatggat ctcgccgctg aatttcatca ccaagcagag catgatctgg       540
     aacgagcatc ataaaggcac ttgcaagtgg tttctggagc gcgatgattt ccgcgagtgg       600
     cgcgagggca gcaatacgag aatattttgt ccggggattc ctggcgctgg caagaccttc       660
     ctctcgtcga tcgtgtacaa cgagctcgag gcgctgaggg tgcgcgatga gggcgggctc       720
     aagggcgctg ccgtcgtcat gctctactgc aaatgggacg atccgctgtc gcaggatata       780
     gacaatcttt tagcgagtgt tattaagcag ttcgtccagc gatacgatgt tggcacaagc       840
     gatatgatgg agctgttcac caagcacagc aaggaaggaa caagatcctc acgtgcacag       900
     ctacagtcga cacttgaact cctctacagc cggttcacaa aagtcttcat catcctcgat       960
     ggactggacg agctgagatc ggagaaggag caactgccgt tgctcatgag cctcgccccg      1020
     aacggctcgc cttacacggt gaatctgatg gtgacttcgc gtccagtgcc gaatattgta      1080
     cgccatttcc ggcattggcc atcgctggga ggcagcataa tctgcgatgg ttgtaacgct      1140
     gagggtctcg ctgtgcagta ccactgcgcg gattgtgagg attacgacct ctgccagagt      1200
     tgctataaag ccggtacgcg ctgcgggtat aagggacata cgtaccacct cgagtttaac      1260
     gctcgcacga ttcctattgc cgccgtggag gaggacctga caacgtacgt gcactggcga      1320
     acgagcgctt ccgaaacttt gcagcaattc ttggagatca aggaagggtt gatggacgca      1380
     atcctagaca cagtcgtgaa gaacaatgag ggaatgtttc tattggccaa gttcaacatg      1440
     gacacgcttg agtcgacgct cagtataaag caactcatgg cggctctcaa gacgctgccg      1500
     caggagctcg atgggacgta cgaagacgcc atgctccgga tcactgagct gaaagcgtca      1560
     acgagggaaa cggtcatgcg ctttctgagc tgggtggtct tcgccgagca gcctctccag      1620
     gagaaagcaa ttgagcatgc gctcgcagtc agcgatggcg atgcggacat agacgacgac      1680
     aacatcatcc gcgccaggac tctagccacc aagtgtgcag gcctggtaca actcgacgag      1740
     tcggactgtc tacggctcgt tcactactca gcagagaact acttcagaca gcaccgtgat      1800
     cggtggttcc cggcagggaa tgtgacaatc gcatcctcct gcctgaccta cctgcagttc      1860
     gacgtcttcc gctccggcgc ctgctctggt ccgtccgagg acatcgactt tgagagccgc      1920
     ctgagcaaat atcccttcct cagatacgcg tccattaact gggggaagca tctccgcgta      1980
     gcggccgacg accacctctc tgctcgagca ctggccctta tcacagatgc aggctgctta      2040
     gccaccattg cccaagcatt atggtatcta gaggatcagc aacagtccaa cagctggtcg      2100
     tcgaagaacg gctctgccct tcacctagca acacactttg atctcgatat cctggtgaaa      2160
     gacctcctct cccagggcta cgacccgaat atgcgcgata tcaatggcgt cacgcctctt      2220
     gcactcgccg ttcaacgaga tttgttggac atattgatca ctctcaccaa tgcaggcgca      2280
     tcggtgaata tgcccgacaa cggcggccgg tccccccttc actgggccat ctatcataac      2340
     ttgcctgacg tcgtcagatt tctgctagat cataaggata ttgacgtcaa tatgcccgcc      2400
     gcgcgctggt cacactacac gccgcttatg ctagcttccg cctatgggtt tgacgactat      2460
     gtgtctatgt tgctaaccaa acccaaaatt gacgtgaact acgccagccc agagggtgcg      2520
     acagccctga tcctcgccgc gcgacatgga ggaacaggag ccgccaggct ccttcttgcg      2580
     aatcaggaga taaagataaa ctacgccgac agcagcggct cgactgcgct aactgtagcg      2640
     gcggaaaatg gttactatga tctggtcgaa gcccttcttg acgcaggagc cgacacagag      2700
     gtgctgcaag aaggaagcaa cggcacggcg atcatgcggg ccattgatga tgggcgtaca      2760
     tccatcgtac agctactggt agacagaggc gcaaacgtcc atcacaagga cgtgtttgac      2820
     cgcggcctct tacattcagc ggctgtaaac cggcgagctg acatattgcg gatcttgctt      2880
     aagcatgatc cgaccctcga cgtgaatatg caagatgtac acggcaaaac gacattacac      2940
     gacatcgcgc gcatggggga tcttgaaacg gtcgatgtgc tccttgaggc tggtggtgat      3000
     ccgaccatta aagatatcca cgggcgcacg ccgatcctcg tcgcgcacga gtcgcaccat      3060
     cctgctattc tggaaatgct tcgcgctgcg aggcagcgga tgaaggcaga agggcaaaac      3120
     tacaaacttc aacgaacccc cagcggtaca acagtcgaca gcgaagacta cggcatcaaa      3180
     cgcgccgaca cgggcctctc cattcatgga accctcccgc tctggtctct tgtggtctcc      3240
     aaacaattca ctgaactgaa agagcgtctg ccggagtcct cacccgagga tatcaatcag      3300
     gttgagccgg atatgggcca agcagcgcta cactgggccg tttccgacag cgatgcctcc      3360
     atcgtgaagc tcctgattga ctatggcgca gacatcaacc ttcgtaaccg ttacgggcgg      3420
     acgccgctct ctcttgccgt tatcgacggt ttgtgggaca aggcacgact cctcttagag      3480
     gccggcgcag atcccgatat cgaagatcag tggggatggc cacctctctg gatggcagga      3540
     ccgaggcttg ggattctgct tattgagaat ggggccaaat tgccgccccc acctacgttc      3600
     acaggcggag gaacagacga aggtgaaaat atcgagaagg ctgctgggaa ggtggatctg      3660
     gaaaacttcc taagatgggc ggcacagttc ggctcggaga ccgcgctccg ccgcctcgtt      3720
     caggcgggag ctgatgtctg gagtaaggac ccgagcggca aaacgccata tatgatcgcg      3780
     aaagagtacg ggtatgacga gctggcaaac ctgctggtgc agcttgcgcc gatgccgcag      3840
     gttggcgctg atgggcccag gccgaaaact gatgagcgtg cggagaaaac tgccacgagc      3900
     ggtatgccgg aggacaaatc tgaggatgga actacaaagg ttaagaccga tgacattgag      3960
     aagccaaaga aggaagaaga cagcgttttg ccggataagg ggatggccct tgatgggctg      4020
     gactctacta ccctcgtacc ggcctctaat gttaacaaga ctaagcctgg ctattctacc      4080
     ttattgcttg gctccgcgca tggacgcgac ggcgttggtg cgatcgtgat gacgataatg      4140
     catgatgggc gtcggttcga ttga                                             4164
//

If you have problems or comments...

PBIL Back to PBIL home page