(data stored in ACNUC16935 zone)

EMBL: BN001307.PE62

BN001307.PE62        Location/Qualifiers
FT   CDS_pept        join(174071..174280,174339..174442,174502..175267)
FT                   /locus_tag="ANIA_09001"
FT                   /old_locus_tag="AN9001.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007853"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007853"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007853"
FT                   /db_xref="GOA:Q5ARS9"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS9"
FT                   /protein_id="CBF84484.1"
FT                   /translation="MQLLKVLPAPLFAALVASAPLAAPQISVDYGQLEQFAQDVQSFAD
FT                   STYSQFSQVSAQFDVLTGSYSGSGRESFGQLLAKLSASVYDIQRVSADIASTIDATASA
FT                   YEDAESSAIGTFFSKRDQLRARDNAAVMAEAGLMKEAGLMGEAGLMNEAGLMNKVDDSI
FT                   APVSGLQTAKDAVADMAEVDGVDDADAMSPVPTAAPSTGSVTPEQATGSGAENVTPEQA
FT                   TGSGAEGLNPQQATGSGAEGVTLEQATGSGAENVTPGQATGSGAEGVNPQQATGSGAEG
FT                   VTLEQATGSAGVDQTLGSDGTGIDENISADATGVDQTLGTADQHVPVVPEDPTAGVTFV
FT                   ANIKTAHEGTVETEDSHRP"
     atgcagctcc tcaaagtcct ccctgctcct ctgttcgcgg cccttgtggc ctccgcaccc        60
     ctggcggctc cccagatttc tgtcgactat ggacaacttg aacagttcgc ccaagatgtc       120
     caatctttcg ccgatagcac ttacagccaa ttcagccagg tgtccgcgca atttgatgtc       180
     ttaactggaa gctactcggg ctctgggcgg gaatctttcg gccagcttct ggcaaagctt       240
     agtgcctcag tttatgacat tcagcgggtt tcagctgata tcgcatcgac tattgacgcc       300
     actgcatccg cgtacgagga tgccgagagc tctgccattg gaaccttctt cagcaagcgt       360
     gatcaacttc gtgctcgaga caacgctgcg gttatggccg aggctggctt gatgaaggag       420
     gctggcttga tgggggaggc tggtttgatg aacgaggccg gcttgatgaa caaagttgat       480
     gattcgatcg cccccgtgtc cggtttgcag actgccaaag atgctgttgc tgatatggct       540
     gaagttgacg gcgtcgacga cgccgacgcc atgagtcctg tccccactgc tgcaccatcg       600
     actgggagtg ttactcctga gcaagccact ggctctggtg ctgagaacgt cacccccgag       660
     caggccaccg gttctggtgc tgagggctta aacccccagc aagccaccgg ctctggtgct       720
     gagggagtca ccctcgagca ggctactggc tctggtgctg agaacgtcac tcctgggcaa       780
     gctaccggtt ccggcgctga gggcgtaaac ccccagcaag ccaccggctc tggtgctgag       840
     ggcgtcaccc tcgagcaggc tactggctct gcaggagttg accaaacttt gggctccgat       900
     ggaacgggca ttgatgaaaa tatcagcgct gatgcaaccg gagttgatca gacccttggg       960
     actgcggacc agcatgtgcc agtggtcccc gaggatccta ctgctggagt tacgttcgtt      1020
     gccaacatta agacggcgca tgaaggaacc gtggagactg aggattcgca ccggccctag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page