(data stored in ACNUC16935 zone)

EMBL: BN001307.PE65

BN001307.PE65        Location/Qualifiers
FT   CDS_pept        join(180933..181923,181980..182188,182230..182504,
FT                   182557..182570,182615..182701,182778..183056,
FT                   183119..183199,183400..183466,183528..183600,
FT                   183901..184047)
FT                   /locus_tag="ANIA_08999"
FT                   /old_locus_tag="AN8999.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007856"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007856"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007856"
FT                   /db_xref="GOA:Q5ART1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART1"
FT                   /protein_id="CBF84489.1"
FT                   /translation="MAKQIQPKPSALATLIPELQWLIFNCLSFDDKVLFTEIGLFHPDL
FT                   LTSHGQTNTYDQHGRTLLHVAAEKGCVRAAQHLLCGGATPSAKMGPGARDFNTTPLILA
FT                   AQQENKELVNLLLSHGADVNDWDYSGITALHYAVIRGDGRIVRILLDKGAKQTNNYDIG
FT                   CPVHVAAASGALEILRLLVAHGADVGASKRGLSALDIALLNGNIAAARILVDAGAPLND
FT                   PVEGWGLFNPTLMVAGGPHAADAAEIVLDHSIASIDSVARQREVEEWWKPRQKGEYAEL
FT                   LQAMLVAGADPNQTFRSATPLHLAVVAGNEHAVRVLLEAGADVHARTDRALQRKEERER
FT                   VGGSTCCASQAGAFQCIWPLIFASISGVQSRSSISSVLRQPGNLCCFTPSLFARFKAHG
FT                   ENACLLFVERSDETRASAQSRGPGCQDSSTHLPAPIPIPMRRGAGSWRARRNVLRFRPM
FT                   YQGCCSKDYSSGFTPEHCDTGRISDCNATAEYGQLCAPTSSDTEVSPRIFAAMAVKRTP
FT                   TALDVASQSAMSFKRRIGYYELFNYYKGCNVIEPESLIIEPFTHINLAFVNLGDDYTLI
FT                   DEYGNIADCVLFLKFSNPGLRVNIAVGGWVFSDAPTQHLWTQMARSHEKQQTFINSVVK
FT                   YPQDYPRGCRASAQWQEVMNRLWQQSEKPLSPENFPGRMNRNDDMRLEARNREIKRTPF
FT                   TYYSRHNHPACQTRIHQWKKEKKVDEREEGDKTTNYPAAKSQSPKH"
     atggccaagc aaatccaacc aaaacccagc gcactcgcca ccctcattcc cgagcttcag        60
     tggctcattt tcaattgctt atcgttcgat gataaagtcc tcttcaccga gatcgggcta       120
     tttcacccgg atctcttgac cagccacggc cagacgaata catacgacca acacggccga       180
     acgctcctcc acgtcgccgc agagaaagga tgcgtaaggg cagcgcagca cctcctctgt       240
     ggcggcgcca ccccatcggc gaaaatgggc ccaggggcac gcgattttaa tacaacaccg       300
     ctaatccttg ccgcccagca agagaacaag gaactcgtga acctgctcct gagtcatgga       360
     gccgacgtta atgactggga ctacagcggc ataacggcac tccactacgc cgtcatacgc       420
     ggcgacggac gcatcgtccg gattcttctc gataagggcg caaagcagac gaacaactac       480
     gacatcggtt gccccgtcca tgtcgcggct gcaagcgggg ccctggagat acttcgactc       540
     ctcgtggcgc acggagcgga tgtcggcgcc agcaagcgag gcctgtcggc gctcgacatc       600
     gcgcttctta atggaaatat cgcggctgcg cggattctcg ttgacgcggg ggcgccgctg       660
     aacgatcccg tcgagggctg gggcttgttc aacccaacgc tgatggtcgc cggcgggccg       720
     catgcggccg atgctgctga gatagtactt gatcacagca ttgcgagcat tgattctgtg       780
     gctcgccaaa gggaggtgga agagtggtgg aagccgcggc aaaaggggga atacgcggag       840
     cttctgcagg cgatgcttgt ggccggcgcg gacccgaacc agacctttcg gtctgccacg       900
     ccgctgcatt tggctgttgt tgctgggaat gagcatgcgg tgcgggttct gcttgaggct       960
     ggggcggatg ttcatgcgag aacagaccgg gctctgcagc gcaaggaaga gagggagaga      1020
     gttggcggat ccacctgctg tgccagtcaa gccggggcgt ttcagtgcat ctggcctctg      1080
     attttcgcca gcatcagcgg agtgcaatcc cgttcctcaa tttcgtctgt tctccgacaa      1140
     ccagggaatc tttgttgctt cactccttct ttattcgctc gtttcaaggc gcacggcgaa      1200
     aatgcatgtt tgctctttgt cgagcgcagc gatgaaaccc gtgcatccgc tcagagccgc      1260
     gggcctgggt gccaggattc tagcactcat ctccctgctc ccattcctat tcctatgcgc      1320
     cgtggcgcag ggagttggag agcccggcgg aacgtgctca gattccgtcc catgtaccag      1380
     ggctgctgca gtaaggacta ctcaagcggc tttacgccgg aacactgtga tactggccgc      1440
     ataagcgact gcaacgcaac ggcagagtac gggcagctct gtgcccccac gagttccgat      1500
     actgaggtgt cacctcggat ttttgcggcg atggctgtca aaagaactcc aacggcgttg      1560
     gacgtggcca gccagagcgc catgtccttc aagcggcgca ttgggtacta tgagctgttc      1620
     aactactaca agggttgcaa cgtgatcgag cccgagagtc tcatcatcga gccatttact      1680
     cacataaatc tggcgtttgt aaaccttggc gacgactaca cgttgatcga cgaatatggc      1740
     aatatcgccg actgcgtctt gttcctcaag ttctccaacc ctggtctgcg cgtgaatatc      1800
     gctgttggag gatgggtatt tagtgacgcc ccgacgcagc acctgtggac gcaaatggct      1860
     cgctcgcacg agaaacaaca gacattcatc aactctgttg taaagtaccc ccaggactac      1920
     cccagggggt gtagggcatc tgcacagtgg caagaggtta tgaatcggtt gtggcaacag      1980
     tcagagaagc ccctatcacc tgagaatttc cccggacgca tgaatcgcaa tgacgacatg      2040
     cgtctagaag ccaggaatcg cgagatcaag agaacgccct tcacatacta ctcccgccac      2100
     aaccacccag catgtcaaac ccgaatccac caatggaaaa aggaaaagaa ggtggatgaa      2160
     agagaggaag gggataagac cacaaactac ccagccgcga agtcacagtc tccaaagcac      2220
     taa                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page