(data stored in ACNUC16935 zone)

EMBL: BN001307.PE67

BN001307.PE67        Location/Qualifiers
FT   CDS_pept        complement(join(188192..188338,188661..189040,
FT                   189465..189516))
FT                   /locus_tag="ANIA_08997"
FT                   /old_locus_tag="AN8997.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007858"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007858"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007858"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART3"
FT                   /protein_id="CBF84493.1"
FT                   /translation="MSTAEQAVWAHVAAVVLGSNAHETLMTKDLLGQTRWQEGRYTNAK
FT                   TLHQEAVDGLIRLKGIDNEDTLTATGNLGRTKAKFYENLDEAKSLLKRASHGMSKVLGT
FT                   THVKTLIVQEDLALLAAQMEEELCEPLETVQQVLDIRTKKLPGRLNESIQYCDEAIKGL
FT                   QKINATQHPLERELRAQKEEMVAMREQEG"
     atgagcactg cagagcaggc cgtctgggct catgttgcag cggtagtgct cggctccaat        60
     gcccacgaga ctcttatgac gaaggatctt ctgggccaga caagatggca agaaggtcga       120
     tacaccaatg ctaaaacgct acaccaagag gccgtcgacg ggctaataag gctcaagggg       180
     atagacaacg aagataccct aacggccacg ggcaatctcg gtcgtaccaa ggccaaattc       240
     tacgagaacc tcgatgaagc aaagtcacta ctcaagcgag catcacacgg catgagcaag       300
     gtactcggga caacgcatgt gaagactttg atcgtgcaag aggacctcgc cctgcttgcg       360
     gcgcagatgg aagaagagct atgtgagcca ttggagacgg tgcaacaagt gctcgacatt       420
     cgaacgaaaa agcttccggg aagacttaat gagagcattc aatactgcga cgaggctatt       480
     aagggtttgc aaaagatcaa tgcgacgcag catccgctag agagagaact gagggcccag       540
     aaagaagaga tggttgcgat gagagaacag gaaggctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page