(data stored in ACNUC16935 zone)

EMBL: BN001307.PE68

BN001307.PE68        Location/Qualifiers
FT   CDS_pept        join(190605..190787,190832..190948,190998..191344,
FT                   191398..191951,192022..192377)
FT                   /locus_tag="ANIA_08996"
FT                   /old_locus_tag="AN8996.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007859"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007859"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007859"
FT                   /db_xref="GOA:Q5ART4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART4"
FT                   /protein_id="CBF84495.1"
FT                   /translation="MATVESKSPIDDVEKAPSEASDEERRREFLSSFTPEDDKRIMNKV
FT                   NRRFLWLIGVIYVIKTIDYTNAAAVKVLQVGEERNVLSELKMTTNEYNWVQSIYFISYI
FT                   VFEVPSNLLQKRLTPRLWQSRIMLTWGIVLACHAAVQNKHALYALRFLLGLCEAGMFPG
FT                   IAAQLCGWYRSDEMATPIMWMFGFQNTSGIIGSLITYGISYMNGLQDLSAWRWVYLLEG
FT                   LFTIAFSGVIFLVLPDWPKSERTKKWLTEREQEYVETRLSENAPKESDASFDKGEVIAA
FT                   LKDQRTYSFMISQILINFAGYALSWQLPTITTSLGFAGLPRNQLLNIPPAAASVLAIIF
FT                   SGWFLKRAYMTRPAYIMSVIIGPMLLFFILLAVLDNKVGIYIACVFGTMFYAVYFIPFW
FT                   AWRSSSLKGMTGSAFTLAFQSCVGQVGGVIGPQLFQSRFAYNGYKTPFAICAAVVGVAW
FT                   LTNGWTWWLTRNVEYDVMRVRRLRIKEEKQGRIYAGEDVQVYKERQFYDGMGRKKEQLE
FT                   V"
     atggcgacag ttgagagcaa gagtccaatt gacgatgtag aaaaagcgcc tagcgaagca        60
     agcgatgagg agagaagacg cgaattcctc tcgtcgttca cgccggagga tgacaagcgg       120
     attatgaaca aggtcaacag gcggtttctc tggctgatcg gcgttattta tgttatcaag       180
     acgatcgact ataccaatgc cgcagccgtc aaggtactgc aggtcggtga agagcgcaat       240
     gtgctgtcgg agctgaaaat gaccacgaac gaatacaact gggtccagtc gatctacttt       300
     ataagctaca tcgtgttcga agttcccagc aacctgctgc agaagcggct cacgccgcgt       360
     ctctggcagt cgcggatcat gcttacctgg ggcatcgtcc tcgcttgcca tgcagctgtg       420
     cagaacaagc acgcgctcta cgccctgcgt tttcttctag ggttgtgcga agctggcatg       480
     tttcctggta ttgcggcgca gctctgcggg tggtatcgca gcgacgagat ggcgacgccc       540
     atcatgtgga tgtttgggtt ccagaataca tcagggatta ttgggtcgct cattacttat       600
     ggcatctcct acatgaatgg gttacaggac ttgagtgcct ggcgatgggt atatctccta       660
     gaaggcctct tcaccatcgc cttctccggt gtaatcttcc tcgtccttcc ggactggcct       720
     aaatcagagc gcacgaaaaa gtggctcact gagcgagagc aggaatatgt ggaaacacgc       780
     ctgtccgaga acgctccaaa ggaaagtgac gccagtttcg acaagggcga ggtgattgca       840
     gctctgaagg atcagaggac ttattcgttc atgatctcgc agatcctcat caactttgca       900
     ggatacgcat tgagctggca gctgcctacc attacgacaa gtcttggctt cgcaggtctg       960
     ccgcgaaacc agctgctcaa tattcctcca gccgcggcgt cggttcttgc catcatcttc      1020
     tctggatggt tcctgaagag ggcgtatatg actcgaccag cgtatatcat gtccgtgatc      1080
     attgggccga tgctgctctt cttcatcctg ttggcggttc tggacaacaa agtcggaata      1140
     tacatcgcct gcgtcttcgg gacaatgttc tatgcagtct attttatccc tttctgggct      1200
     tggcggagtt cgtccctgaa aggtatgacc ggatctgcat tcacactcgc cttccagtcc      1260
     tgtgttggcc aagtcggcgg tgtaattggg ccacagctct tccagtcgcg cttcgcatac      1320
     aacggataca agacgccatt tgcgatctgc gccgccgtgg ttggggtggc atggttgacg      1380
     aatgggtgga cgtggtggct gacgcggaac gtcgagtacg atgtcatgcg cgtaaggcgg      1440
     ttgcggatca aggaggagaa gcagggccgg atctacgccg gcgaggatgt ccaggtctat      1500
     aaggagcggc agttctacga tgggatgggg aggaagaagg agcagctgga ggtgtag         1557
//

If you have problems or comments...

PBIL Back to PBIL home page