(data stored in ACNUC16935 zone)

EMBL: BN001307.PE69

BN001307.PE69        Location/Qualifiers
FT   CDS_pept        join(192843..193012,193068..193974)
FT                   /locus_tag="ANIA_08995"
FT                   /old_locus_tag="AN8995.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007860"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007860"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007860"
FT                   /db_xref="GOA:Q5ART5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART5"
FT                   /protein_id="CBF84497.1"
FT                   /translation="MASTSTENGPEKASATATIALNEPPAPAPAPSHPAKEGGLRGWLQ
FT                   VLSTLFILFNIWGLAFAFGSFQSFYVLDFLPSTSTSAISWTGTIQSWLLIMGGLVSGPL
FT                   FDLGYYVHLISIGSFLSVFGIMMLSLATKYYQILLSQGICAGLGFGLLYIPSLTIVSRT
FT                   FVRKRALALGIATAGAPAGGVIYTLMFEQLLPRAGFAWTVRIIGFVMLGLFIAAGVMVS
FT                   FTADTAKPSQARRPAVGKRQLFDTAALKDLPFWSYTLANFFLYLGYMSPFYYIPIYAET
FT                   KLHTSRSMGLYILIISQASSIIGRVVTTAVAHYFGAMVPWIITGIASGVLCMAWISATT
FT                   LARFILFAAFYGILLPEP"
     atggcttcca cctctacaga gaacggtcca gaaaaggcgt ctgccactgc gactatagct        60
     ctcaatgaac cgccagcacc agcaccagca ccatcacatc cagccaaaga aggcggactc       120
     cgtggctggc tacaggttct cagcaccctc ttcattctat tcaacatttg ggggctagcc       180
     ttcgccttcg gctccttcca gagcttctat gtgctcgact tcctcccctc aacatcaaca       240
     tccgcgatat catggacggg aaccatccag tcctggcttc tcataatggg cggtcttgtc       300
     tcaggcccgc ttttcgatct tgggtactac gtccacctca taagcatcgg ctccttcctg       360
     tctgtctttg ggattatgat gctctcgcta gctacgaaat attaccagat cctgctgtcg       420
     cagggaatct gcgctggact cgggtttgga ctactctata tccctagtct gacgattgtt       480
     agccggacct ttgtgcggaa acgcgcattg gcattgggaa tcgcgacggc gggtgcgccc       540
     gcggggggcg tgatttatac gctcatgttt gagcagctgc tgccgcgcgc gggtttcgcg       600
     tggacagtga ggataatcgg gtttgtgatg ctgggactgt tcatcgccgc aggagtcatg       660
     gtctcgttca ctgcggacac agcgaaaccc agccaggctc ggagaccggc agttggaaaa       720
     cggcagctgt tcgatacggc agccctgaaa gacctccctt tttggtccta tacgctcgca       780
     aacttcttcc tctatctcgg ctacatgtcc ccattctact acatcccgat ctatgcggag       840
     accaagctac atacctcgcg gtcaatgggg ctctacattc tgatcatctc tcaagcatct       900
     tctataattg gacgcgtagt tacaacagcc gtcgcgcatt actttggcgc gatggtgcct       960
     tggattatca ctggtattgc tagcggcgtg ctctgtatgg cctggatcag tgcaacgacc      1020
     ctggcacgct ttatcctttt tgctgctttc tacggtatac ttctccccga gccctag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page