(data stored in ACNUC16935 zone)

EMBL: BN001307.PE7

BN001307.PE7         Location/Qualifiers
FT   CDS_pept        join(24506..24670,24737..25444)
FT                   /locus_tag="ANIA_09054"
FT                   /old_locus_tag="AN9054.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007799"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007799"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007799"
FT                   /db_xref="GOA:Q5ARM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM6"
FT                   /protein_id="CBF84383.1"
FT                   /translation="MRSSIALVLAVGTAALADFTFDELWALQNTLWDNFLYPANLQQIN
FT                   ATDTSVFAENVQGRVDITRTFDGRELNNEYIFGLFSDPSHLSLVGIPISYNITQFAANQ
FT                   NITSATTVFTFNATSFNILVPITIDTWILYNADGKILQYDATFRWFGWLLDTLLEAAGT
FT                   GIFNTTDPAETQRALGNLLATTICQTHGQHCVDDNQQYNSNEDCVRFLTEDIRFGSAYE
FT                   LGRNTLLCREVHEHMVQYRPTEHCPHIGPDGGGYCVDDKDYAEVVTERYFREPFVPYGY
FT                   GDTNLWVAA"
     atgcgctcct caatagccct ggttctcgcg gtgggaacag ccgccctggc tgatttcacc        60
     ttcgacgagc tctgggccct ccaaaatacc ctctgggata acttcctcta ccctgccaac       120
     ctccagcaga ttaatgccac agacacctcc gtcttcgctg agaatgtgca aggccgcgtc       180
     gacataacac gcacatttga cggccgcgag ctcaacaatg aatacatatt cggtcttttc       240
     tcagacccct cgcatctcag cctcgtcggc atcccaatct cttataacat cacgcagttc       300
     gcagccaatc agaacatcac gtccgcaacg acagttttca cattcaacgc aacctcgttc       360
     aatattctcg tccctatcac cattgatacg tggatcctat ataacgcgga cgggaagatc       420
     ctccagtatg atgcgacctt ccggtggttt ggctggttgc tggataccct tctcgaagct       480
     gcgggaacgg gcatattcaa taccacagac ccagcggaga cgcagagagc gctggggaat       540
     cttctagcaa caacaatttg ccagactcac ggtcagcact gtgttgatga taaccagcaa       600
     tacaacagca acgaggactg tgtcaggttc ctcacggagg atatccggtt cggaagcgct       660
     tacgagctgg gtcgtaacac gctgctttgt cgcgaggtgc atgagcatat ggtgcagtat       720
     cggccaaccg aacactgccc gcatattggg cctgatgggg gcggttactg tgttgatgat       780
     aaggattatg cggaagttgt cacggagagg tacttcagag agccgtttgt gccatatgga       840
     tatggagaca cgaacctctg ggttgctgca taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page