(data stored in ACNUC16935 zone)

EMBL: BN001307.PE70

BN001307.PE70        Location/Qualifiers
FT   CDS_pept        complement(join(194447..194817,194886..195387))
FT                   /locus_tag="ANIA_08994"
FT                   /old_locus_tag="AN8994.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007861"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007861"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART6"
FT                   /protein_id="CBF84499.1"
FT                   /translation="MHYDQPPAYTETTLTAASLVGPALDRPSSSHSSTASIPSVSISLS
FT                   NTTATETSPKGGDASSSFAMLSLGDSDKLRFIRFPDHLIVIASEVITRLWPKGIQKTQN
FT                   FDESVQFKLKGNPLGYSFDGEKAAIRVTIMGLLNAFAKEGWVVLPAGKVGKMGRGDSQS
FT                   YGQGDSLVFHRQHPESRSWLCVSFDSADLLHLLNAPAELTTLLLASFGDRIEKCNKDFV
FT                   SGNFELKFKGSPWTKTGAKGAVQCRLILLDLMQCFEEHGYTMCTALDIDGGLGGTEYKS
FT                   NGEAWFWYR"
     atgcattacg accaaccgcc agcctacact gaaacaacct tgacggcggc ttcattagta        60
     ggcccagctc tagaccgccc ctccagctca cactcatcca ccgcctcaat accgtctgta       120
     tccatctccc tctccaatac tactgccaca gaaaccagcc caaagggtgg cgatgcctcc       180
     agctctttcg ccatgctctc actcggcgac tcggacaaac tccgcttcat taggtttcct       240
     gaccatctaa tagtgatcgc gtccgaagtg attaccaggt tatggccaaa gggaatccag       300
     aagacgcaga atttcgacga gagtgtgcaa ttcaaactga agggaaatcc actcggatac       360
     agctttgacg gcgaaaaggc cgccatcagg gtgacgatta tgggtctttt gaacgcgttc       420
     gcgaaggagg gctgggttgt gcttccggct ggtaaggtgg gtaaaatggg tcggggcgat       480
     tctcagagtt atgggcaggg tgacagccta gtcttccatc ggcaacaccc ggaatcacgc       540
     tcatggctct gcgtctcgtt cgactcagcc gatctcttgc acctgcttaa tgcgcctgcc       600
     gagcttacaa ccttattact ggcctctttt ggcgaccgta tcgagaaatg caacaaagac       660
     ttcgtctcgg gaaacttcga gctcaagttc aaggggagcc cgtggacaaa gaccggcgcc       720
     aagggcgcag tgcagtgccg actgatcttg ctggacctca tgcagtgctt cgaggagcat       780
     ggttatacca tgtgcacagc gttggatata gatggaggcc tcggcgggac tgagtacaag       840
     agcaatgggg aggcgtggtt ttggtatcga tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page