(data stored in ACNUC16935 zone)

EMBL: BN001307.PE71

BN001307.PE71        Location/Qualifiers
FT   CDS_pept        join(196975..198404,198774..198781,199152..199217,
FT                   199300..199327,199393..200572)
FT                   /locus_tag="ANIA_08993"
FT                   /old_locus_tag="AN8993.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007862"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007862"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007862"
FT                   /db_xref="GOA:Q5ART7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART7"
FT                   /protein_id="CBF84500.1"
FT                   /translation="MMQIDLADDQDERQRRLQEWDSDDDPGNPRNWSTLRKTLTTTVIG
FT                   LIGFATTVNASIYSSGHEQVKRDFNVSTTVSLLPLSAYSLGLAFGPMISSPLSETFGRK
FT                   FVYLLTLPMVDLFTLGVGASQGIASLIVCRFVAGVFAAPGVSVAAATITDYTPPSRRVI
FT                   PLGIYYAIPTIGSSMGPLIGSFVVEQRGWRWTAWTPLIMAAVVHPPAIFIRESYKPILL
FT                   QRRAEKLGGEGVLPVQRQTAMQLFKEFVTSTIVRPLHMLFTEPLVGFICLYCGFQFALL
FT                   YTFIVASPRVFADVYGFSPSGQGLSFLGMVAGCICAPLVLFTVDRIVQLNPTLRIRNNN
FT                   TEGGGSPPELKLYTAMFGSLILPTGLFLFAWTAKPHIHWMAPIVAQSLTFLGSMLIYIP
FT                   CNFYMLDVYGSKYGASASGASSLTRYTLSTAFPLFVPQMYDALGVDWATSLLGFLATVM
FT                   APIPWVFFYKGPGFRARSGINIYIIPRSLKLAKENVAKGQPFGPVHWGRISGLFAGHLR
FT                   TQGIRTSPGPSSARFGSVHSNHSYSYILSPICLPINKATLSEMTAPHRRKPIPQPHGRS
FT                   HSHPTAISHPHPHSPAPAYTRPAQPRAPQQMAYHPPQSLAHGTPAPARSRSHYLPHPRS
FT                   APAQARQLSHIQTTQRHHGQQLKQHTTQISQHANTMKSQAKLNQSAQKENAQIAKSMQK
FT                   QFAAQQKTFNKHANAQQRAFDKQSAAHQKHFEKQNAALAAQYERDRAAMDHEMEQIRHA
FT                   DAQRQYEYEQYMWYKSQAQVEQDRKDWDKTVAGVVAGAALGAAAGAAAGVAWEREQWEE
FT                   QRLQAEAERQEDSSELEPSDYEYESRNEGYQTQSLGYDNGNSGYNDSGYEQQQPYTSLD
FT                   FMTQNRDGNDGDDDCCDGCCGGNGNDDDDCCC"
     atgatgcaaa tagacctcgc agacgaccaa gacgaaagac agaggagact ccaagaatgg        60
     gacagtgacg acgacccggg gaatccgcgc aactggtcca cgctgagaaa gactctgaca       120
     acgaccgtca tcggcttgat tgggttcgca accactgtca atgcctccat ctattcttct       180
     ggtcatgagc aggtcaaaag agacttcaat gtgtcaacga cggtctctct gcttccgctt       240
     tcggcatact ccctgggact ggcatttgga ccgatgatct cctctccact ctctgagaca       300
     ttcggccgca aattcgttta cctccttacc cttccgatgg tggatctctt cacgctcggt       360
     gtcggggcgt cgcaggggat cgcttcgttg atagtgtgcc gcttcgtcgc cggcgtcttc       420
     gcagcaccgg gcgtctcagt ggcagcggcg acaattactg actacacacc cccttctagg       480
     agagtcattc cgctggggat ctactacgca atcccgacaa taggaagctc aatgggtccc       540
     ttgatcggtt catttgtggt cgagcagcgc ggctggcgat ggacggcatg gacaccgctc       600
     atcatggcgg cagtcgtcca tccgccagcc atcttcatca gagagtcata taagccgatc       660
     ctgttgcaaa ggcgcgcaga gaaactgggt ggcgaaggtg tcctgcctgt gcagcgccaa       720
     actgcaatgc agctctttaa agaattcgtc acctcgacca tcgtccgccc gctccatatg       780
     ctcttcaccg agcccctcgt cggcttcatc tgcctctact gcggcttcca gtttgccctg       840
     ctctacacct tcatcgtcgc cagcccgcgc gtttttgcag acgtctacgg cttctcccct       900
     tctggtcagg gcctctcctt cctaggcatg gtagccggct gcatatgtgc acctctagtc       960
     ctcttcacag tcgaccggat tgtgcagcta aatcctaccc tccgaatccg aaataacaac      1020
     actgagggcg gcggatcgcc cccagagctc aagctctaca cagccatgtt tggctctctc      1080
     atcctcccca ccggcctctt cctcttcgcc tggacggcga aaccgcacat ccactggatg      1140
     gcccccattg tagcacaaag cctgacattc cttggcagta tgcttatata catcccctgt      1200
     aacttctaca tgcttgacgt gtatgggtct aaatacgggg cgtctgcaag tggggcgtca      1260
     agcttgacaa ggtataccct ttccactgcg ttcccgctgt tcgtaccgca gatgtacgac      1320
     gcgctggggg tggactgggc gactagtctt ctgggatttc tagctacggt gatggcgccg      1380
     attccgtggg ttttcttcta caaggggcca gggtttcggg cgcgtagtgg aataaacatt      1440
     tacattatcc cacgcagcct aaaattagcc aaggaaaacg tcgccaaggg ccagccgttc      1500
     gggcccgtgc attggggtcg gattagtgga ttgttcgcag gacatctgag gacgcagggt      1560
     ataagaacat cgccgggtcc atcctctgca aggttcggct ccgttcactc caatcattct      1620
     tacagctaca tcttgagccc tatctgcctg cctattaaca aggctactct atccgaaatg      1680
     accgcaccac accgccgtaa accaatcccc cagcctcatg gccgctctca ctctcatcct      1740
     accgctattt cccatcccca tcctcactcc ccagcgccgg catacaccag acctgctcaa      1800
     ccccgtgcac cacagcagat ggcataccat cctcctcagt ctctggccca tggtactcca      1860
     gctccagcac ggtctcgctc ccactacctc cctcatcccc gctcggctcc agcgcaagca      1920
     agacaactct cccacattca aacaacgcag cgccaccacg gccaacagtt gaaacagcac      1980
     accactcaga tatcgcagca tgcaaataca atgaagtccc aagcgaagct aaaccaaagt      2040
     gcccagaaag agaacgcgca gatagcaaag agcatgcaga aacaattcgc agcacagcaa      2100
     aaaacattca acaagcacgc caatgcacaa caaagggctt ttgataagca atctgctgcg      2160
     caccagaagc acttcgagaa acagaatgct gcccttgcag ctcagtatga gagagaccgc      2220
     gccgcaatgg accatgaaat ggaacagatc cggcatgctg atgcgcagag gcagtatgag      2280
     tacgagcaat atatgtggta taagtcacag gcgcaggtgg agcaagacag gaaagattgg      2340
     gataagactg ttgcaggtgt tgttgcagga gcggcacttg gggctgcggc cggtgcagca      2400
     gcgggggttg catgggaaag ggagcagtgg gaagagcagc gattgcaagc tgaagctgag      2460
     cggcaggaag attcgagcga actagagcca tctgactatg agtatgagag caggaacgag      2520
     gggtatcaga ctcagagttt ggggtatgac aacggcaact cggggtataa cgacagtggg      2580
     tatgagcagc agcagccgta tacatctctc gactttatga cgcagaatag ggatgggaac      2640
     gacggggatg acgactgctg cgatggttgc tgtggaggga atgggaatga tgacgacgat      2700
     tgctgttgct ga                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page