(data stored in ACNUC16935 zone)

EMBL: BN001307.PE72

BN001307.PE72        Location/Qualifiers
FT   CDS_pept        join(201294..202154,202268..202388,202433..202452)
FT                   /locus_tag="ANIA_08992"
FT                   /old_locus_tag="AN8992.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007863"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007863"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007863"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART8"
FT                   /protein_id="CBF84502.1"
FT                   /translation="MSYPTVRPSRLTVFSRDGTLIIIVPLNHEAGAGEQGGPGQGSLPA
FT                   QPPAAGFRTSADQLKRVSPLMNRVLTTLEAQTMLRSPRGLDYVLPKYDPDLVRLFLTIL
FT                   HNPQHPITPLTDLLQIAKLTQIAAFFECPSLIASHVSAWLSSRDSEPPRTYCPTLMVFV
FT                   SISLHLHFDNMFAKYTSIAIAESPGQITSMGAPISGDVLEDLNQRRNCFIGAHFDVLHN
FT                   TLNVLLKGPPGCTVDCDSRMLDALMNQMKQHGLLRPKPAAPYSGLTHRQLASTIASFKC
FT                   PAGVDMKTVLTLPPSLQNAAFIWSLRVQQADYVPFCSWTCSLQRIAGQLEWV"
     atgtcttacc ctactgttcg tcccagccgc ttgacggtct ttagccgaga cggcacactt        60
     atcatcatcg tgcccctcaa tcacgaggct ggagcaggcg agcaaggtgg accaggacaa       120
     ggctctctac cagctcagcc tcctgcagcc ggattccgca catcagccga tcaattgaag       180
     cgtgtctcgc ctctaatgaa cagggtcctt accaccttag aagctcaaac catgttacgt       240
     tcgccgcgtg ggcttgatta tgtgctaccc aagtacgatc ccgatctcgt ccggttgttc       300
     ttgacgatcc ttcacaaccc gcaacacccc attacgcctc ttaccgacct ccttcaaatt       360
     gcaaagctca ctcaaatagc agcgtttttc gaatgcccct ctcttattgc ctcccatgtt       420
     tctgcgtggc tatcgagcag agactccgaa ccgcccagaa cctattgtcc caccctcatg       480
     gtttttgtgt cgatttcgct ccacctccac tttgacaaca tgttcgccaa gtacactagt       540
     attgcaatcg cagagagccc tggacagatt acttccatgg gcgctcccat ttctggtgat       600
     gtcctcgaag atctaaacca gcgccggaat tgcttcatcg gcgcccattt cgacgttttg       660
     cacaacactc ttaacgtact ccttaaaggg cccccaggat gcactgtaga ttgcgattct       720
     cggatgttgg atgctctgat gaaccagatg aaacagcatg gcctccttcg acccaagcca       780
     gcggcgccct atagcggtct cactcaccgg cagctggcct caaccatcgc ttccttcaaa       840
     tgtccggctg gagttgatat gaaaacagtc ttaactttgc cgccttccct ccaaaatgcg       900
     gcatttattt ggagcttacg agtgcaacaa gcagactatg tgccgttttg ctcatggact       960
     tgcagtcttc aacgaattgc gggtcaactc gaatgggtat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page