(data stored in ACNUC16935 zone)

EMBL: BN001307.PE73

BN001307.PE73        Location/Qualifiers
FT   CDS_pept        join(203563..203773,203858..203914,204148..204169,
FT                   204294..204378)
FT                   /locus_tag="ANIA_08991"
FT                   /old_locus_tag="AN8991.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007864"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007864"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007864"
FT                   /db_xref="GOA:Q5ART9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART9"
FT                   /protein_id="CBF84504.1"
FT                   /translation="MHMPPSQKEQPGWHRAPRLLNQGFQYLWEQRVDSSPGSNGVWSLT
FT                   LDKWTFSVYEYSSDAEQFCAKGDCAGRTGGSSARIAWGTRFWSADKGLEEGSGGAVRLE
FT                   ARTDVIVAEQNSLTWYRDWR"
     atgcatatgc cgccctcgca aaaagagcag cccggttggc atcgtgcgcc gcgtcttctg        60
     aaccagggct tccagtacct gtgggagcaa cgcgtagatt catcgccggg ctcaaacgga       120
     gtgtggagct tgacgctaga taagtggaca ttctccgtct atgagtacag ctcggatgcg       180
     gaacagtttt gcgcgaaagg tgactgcgcc ggacgtactg gtggatcttc ggcgcgcatt       240
     gcatggggga cccggttctg gtctgccgat aaaggtttag aggaagggag cggaggtgcg       300
     gtacgtttag aggccaggac agacgttata gtggccgagc agaactccct cacctggtac       360
     agggattggc gctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page