(data stored in ACNUC16935 zone)

EMBL: BN001307.PE75

BN001307.PE75        Location/Qualifiers
FT   CDS_pept        complement(join(208084..208110,208214..208356,
FT                   208448..208649))
FT                   /locus_tag="ANIA_08989"
FT                   /old_locus_tag="AN8989.4"
FT                   /product="glyoxalase family protein (AFU_orthologue;
FT                   AFUA_5G14830)"
FT                   /note="transcript_id=CADANIAT00007866"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007866"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007866"
FT                   /db_xref="GOA:Q5ARU1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU1"
FT                   /protein_id="CBF84508.1"
FT                   /translation="MELDPTAPLPSSKIDHIGITAPTEQLESLIEFYLKALALAPLQRD
FT                   HAVSWGCWARRQGPGFLDLRDEDRKTVDAFHEAALAAGGKCNGKPGLRTEYHPNYYAAF
FT                   IIDPRGNNVEIVCHLPVEE"
     atggagctcg acccgacggc gcctctcccc tccagcaaga tcgaccatat tgggatcacc        60
     gccccaaccg agcagctcga atccctcatc gagttctacc tcaaagcgct ggctctcgct       120
     ccactacaaa gagatcatgc ggtttcctgg ggctgttggg ctcggagaca aggtcccgga       180
     tttctggatc tcagagacga agatcgcaag acggtcgatg cgtttcatga ggctgcgctc       240
     gccgctggcg gaaagtgtaa cggcaagcct ggtctacgga cagagtacca tcccaattac       300
     tatgcggcct ttatcataga ccccagaggc aacaatgtgg agattgtatg ccatttgccc       360
     gtggaagagt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page