(data stored in ACNUC16935 zone)

EMBL: BN001307.PE76

BN001307.PE76        Location/Qualifiers
FT   CDS_pept        complement(join(209040..209128,209210..210022,
FT                   210076..210298))
FT                   /locus_tag="ANIA_08988"
FT                   /old_locus_tag="AN8988.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007867"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007867"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU2"
FT                   /protein_id="CBF84510.1"
FT                   /translation="MPKLFITGITGYIGGDAFHLLSQKHRDFEFSALVRTEAKAKYVRE
FT                   LYPNVRIVIGGLDDADKIEKEAAWADIVLHTADSSDHVGAANAIARGLVQGHSLDRPGY
FT                   WLHTGGTGILTYFDSDVHKVHGEHNDKVFNDYEGVSELTNLPAAAFHRNVDEIVLRTGV
FT                   EHADRVKTVIVCPPTIYGRGRGPVALRGRQAYELTSFVLKEKYVPIIGKGLARWNNVHI
FT                   YDLSRLFDLLVRAALDPARKDDKEIWGEKGYFLCENGEHVWGELSKLVGEQAHKLGYLK
FT                   DAPVVKEMSVDEAISSPAGFEAASWGWNSRGQAQRGREVLGWSPEEKSIEEEIPDILAA
FT                   EASRLDGQFSLTIMFPPTGETRLLIAVESSFADE"
     atgcctaagc ttttcatcac cggcatcacc ggctacatcg gcggcgacgc tttccacctg        60
     ctctcgcaga aacaccggga cttcgaattc tccgcactgg ttcgcacaga agcgaaagca       120
     aagtacgtgc gcgagctgta tccaaacgtc cggatcgtca ttggcggtct tgacgatgcg       180
     gacaaaatag agaaggaggc tgcgtgggcg gatattgtgc ttcataccgc cgactcatcc       240
     gaccacgtcg gtgcagcgaa tgcgatcgcc aggggactgg tgcaaggcca ctcgctggac       300
     cgcccggggt actggctgca caccggtggg acaggaatcc tgacatactt cgactcggac       360
     gtccataagg tccacggcga gcacaacgac aaggtcttca acgactacga aggagtttcc       420
     gaactgacca atcttcccgc cgctgcgttc caccgcaatg tcgacgagat cgttctcagg       480
     acgggcgttg agcatgccga ccgcgtcaag acggtcatcg tctgcccacc gaccatctac       540
     gggcgtggac gaggccccgt cgcgcttcgt ggccggcaag cgtatgagct cacctcgttc       600
     gttttgaagg agaagtatgt cccaattatc gggaaaggat tggcgaggtg gaacaatgtg       660
     cacatatacg acctgagccg gttattcgat ctgcttgtgc gggcggctct ggatcccgcc       720
     aggaaagacg ataaagagat ttggggcgag aagggatact tcctctgtga gaatggagag       780
     catgtctggg gcgaactgtc gaagctggtc ggcgagcagg cgcacaagtt ggggtacctc       840
     aaagacgctc cagtggtcaa agaaatgtcg gtggacgagg cgatcagttc gcctgctggc       900
     tttgaggcgg ccagttgggg gtggaactcg agggggcagg cgcagagggg acgggaagtg       960
     ctgggatggt cgccagagga gaagagcatt gaggaggaga tccccgatat tcttgctgcg      1020
     gaggcttcga ggctcgacgg acagttcagc ttaacgataa tgtttccacc aaccggtgaa      1080
     actcgtctgc ttattgcagt cgaatcatcg ttcgccgatg agtaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page