(data stored in ACNUC16935 zone)

EMBL: BN001307.PE77

BN001307.PE77        Location/Qualifiers
FT   CDS_pept        complement(join(210491..210617,210693..210780,
FT                   210882..211314,211855..212244))
FT                   /locus_tag="ANIA_08987"
FT                   /old_locus_tag="AN8987.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007868"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007868"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007868"
FT                   /db_xref="GOA:Q5ARU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU3"
FT                   /protein_id="CBF84512.1"
FT                   /translation="MVLAQRLLGVLLVDIGLLQLVVVVSRNRAGVYLTQYTPRVRRKLN
FT                   RNSTEMCINLRGYSRLSMGVVELTIRLRGSWRLSMWAGQHRDVDGHSLSPLTDVAVNQR
FT                   AIFQNGLRKQRSMRYCSLVLLLEGQAVIDIRSQWGGLAVKIGPEWARLQNCRPGENPVT
FT                   LSGEDHRIVMGWRYRAASGLIRRPSPAWLDSSPVSNSQQQSPGKPQQDHALMAEMMMKK
FT                   KQRVVIAKLSTRSLREEETCAAGGSRSPAPFPPVILWSATFSSLTAALCLNWPSRLAWT
FT                   SHQPQGQISGDNPEHQNDKTFEHVDDTPVDHHEERKSGSNERYVHLFLHVNTMLLPWIT
FT                   VAHQP"
     atggttcttg cgcaacgcct actgggagtg ctgctggttg acatcggtct gcttcagttg        60
     gtcgttgtcg tctctagaaa cagggctggt gtttacctta ctcagtatac gccccgggtt       120
     cggcgcaagc ttaatcggaa tagtacagag atgtgtatca acctgcgtgg atactccaga       180
     cttagcatgg gcgttgtaga actgactatc agattacgtg gatcatggcg tctctccatg       240
     tgggcaggac aacacagaga cgttgacggc catagcttga gcccgctaac tgacgttgcc       300
     gttaatcaac gtgctatatt ccaaaatggc ttgcgaaagc agcggtcaat gcgctattgt       360
     tcacttgtat tactgctcga ggggcaggcc gtcattgata tacggagtca atggggtggg       420
     ctggctgtca aaataggtcc tgaatgggca aggctacaaa attgcaggcc tggcgagaac       480
     cctgtcactc taagcggaga agaccatcgg atcgtaatgg gctggcgcta tagagctgcc       540
     agtgggctca tcaggcggcc atcgcctgcg tggttggatt cgtccccggt ctcgaacagc       600
     cagcagcaat cgccaggaaa gcctcagcag gaccacgccc taatggcaga gatgatgatg       660
     aagaaaaagc aaagagtcgt cattgcgaag ttgagcacaa gaagtctgag agaggaagag       720
     acatgcgctg ctggtggttc aagaagccct gcgccgtttc ctcccgtgat attgtggtct       780
     gctaccttta gcagtctgac agctgcgctt tgtcttaact ggccatctcg tctagcatgg       840
     accagtcatc aaccacaggg tcaaatttct ggagataatc ccgagcatca aaatgacaaa       900
     accttcgaac acgttgacga cactccggta gatcaccacg aggaaaggaa gagtggctca       960
     aatgagagat acgttcatct gttcctgcat gtcaacacta tgctcctgcc ctggatcact      1020
     gttgctcatc aaccctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page