(data stored in ACNUC16935 zone)

EMBL: BN001307.PE78

BN001307.PE78        Location/Qualifiers
FT   CDS_pept        join(215468..215878,215937..216779)
FT                   /locus_tag="ANIA_08986"
FT                   /old_locus_tag="AN8986.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007869"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007869"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007869"
FT                   /db_xref="GOA:Q5ARU4"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU4"
FT                   /protein_id="CBF84514.1"
FT                   /translation="MRRASRQSFLPLLARRRLSFLLILLFLLFLLHALPPVFSQRRNRR
FT                   VVGGKWLPDYDVNELPRYLHRSPYREKPDIEFEQRVREALKGIEEDALAAAGIGDDRLA
FT                   EQRIWQIRLGGGNDEHVEDSLAFTKRNSEWEYTLMTDHQANEFIATVLASIPDLKALYD
FT                   SYPYHVMRSDLLRYLVLWYYGGYYADMDVYPAKAIKECPALQPVFGDSGSANISLAVGI
FT                   EIDEPHASLQLMRDWHWIRTYGLIQYTFFAPRRFSPLLREVIIRVLSHTRQRNQQSFPF
FT                   VGPRYDEKAILEVTGPGVFTDAILDALSDALPTTHPLLAASVRADEGIGDLFSQASGQL
FT                   SRRVTWAPFHRISEPLCVDAQEAAVGKSMGGICVLPVNAWGNGQRHSGAGGFSSPLACV
FT                   NHRFGGSWKKDWWYRHFG"
     atgagacgag cgtcccggca atccttcctg ccgcttctcg cgcgacggcg cctttccttc        60
     ctgctcatcc tgcttttctt gctctttctc ctccatgcgc tgccgccggt gttttcccag       120
     cgcaggaacc ggcgcgttgt cggtggaaag tggctacccg actatgatgt caacgaactc       180
     ccgcgatacc tgcaccgctc accgtaccga gagaagccag atattgagtt tgagcagagg       240
     gtgagagagg cgttgaaggg gattgaggag gatgcactgg cagctgcagg aattggagac       300
     gatcgtctgg ccgaacagcg catctggcag attcgtttgg gcggcggcaa tgacgaacac       360
     gtggaggact cgttggcgtt caccaagagg aacagcgagt gggagtacac tctcatgact       420
     gatcatcagg cgaacgagtt catcgcaacg gtcctcgcgt cgatccccga tctcaaagcc       480
     ctgtacgatt cgtatcccta tcacgttatg cgatccgatt tgctgcggta cctggtgctg       540
     tggtactacg gcggatacta cgccgatatg gacgtctacc cggcgaaagc tatcaaggag       600
     tgcccggctc tacagcccgt cttcggcgac tcgggcagcg cgaatatctc tctggccgtc       660
     gggattgaga ttgacgagcc gcacgcatcg ctgcaactga tgcgcgattg gcactggatt       720
     cgaacttacg ggctgattca gtataccttc ttcgccccgc gacgattcag cccgctgctc       780
     cgtgaagtaa tcatccgcgt tctctcacac acccgccagc gcaaccagca gagcttccct       840
     ttcgttgggc cacggtacga cgagaaggcg attcttgaag tcaccggccc cggcgtcttc       900
     acggatgcca ttctggacgc tctctcggac gctctcccga caacgcaccc gttgctcgcg       960
     gcgtccgtcc gagcagacga agggatcggc gacctcttct cccaagcgtc cggacagctc      1020
     tcaagacgtg tcacatgggc ccccttccac aggatcagcg agcccctctg tgtggatgcg      1080
     caagaggcgg ccgtgggaaa gtcgatgggc ggaatctgcg tgctgccggt gaatgcgtgg      1140
     gggaatgggc agcggcatag tggtgcgggg ggcttttcta gtccgcttgc ttgtgtcaat      1200
     caccggtttg gggggtcatg gaagaaggac tggtggtacc ggcattttgg gtag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page