(data stored in ACNUC16935 zone)

EMBL: BN001307.PE79

BN001307.PE79        Location/Qualifiers
FT   CDS_pept        join(217281..218362,218406..218464,218511..218962)
FT                   /locus_tag="ANIA_08985"
FT                   /old_locus_tag="AN8985.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007870"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007870"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007870"
FT                   /db_xref="GOA:Q5ARU5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU5"
FT                   /protein_id="CBF84515.1"
FT                   /translation="MAEYTSDADVELAYTTLQTTFKSGKTKEIAWRKWQLKQIWWLVDD
FT                   NEALIQEALKKDMNRHPFETTFTECANVKGDVIEHLKNIDKWTADQKPSAGMLGLMLRP
FT                   TVRPEPLGVALIIGPWNFPFSLLVQPLIAAITAGCAALLKPSEVTSSVQQLFVDLVPKY
FT                   LDTSAVRVVTGGPAETGCLLQRKFDHIFFTGSVPVARHIAAAAAKHLTPTVLELGGQCP
FT                   AIVTSSADVDAAAKDIAWIKYLNAGQICLSVNHVFAHPSVERKLIERMAFWLDRFYKGE
FT                   KDAMTHIVNDKNYARIKQLAEKTKGKIELDGTADAETRSLPVSIVSNVEMSDPLLSEEL
FT                   FGTVCPVIKGSTDDAIKSINSLPRPLALYIFSQDQNEVEHIISSTLSGGVCVNGVLVHA
FT                   MVPNAPFGGVGDSGHGAYHGEYGFKSFTHYRTIARPAPFFFKMSEWMRPPYSVDNIKKL
FT                   AVRNSVGIQRNWSLEQEREAIKRGLLLTKSLKSARFLVYLVVLLGLADVGLDRRLGVLK
FT                   SVRDLLVEVRSLF"
     atggctgaat atacctctga cgcagatgtc gagctcgctt acaccacgct gcagacgacc        60
     ttcaaatccg gcaagaccaa ggagattgcc tggcgcaaat ggcagctcaa gcagatctgg       120
     tggctcgttg acgacaacga ggctctgatt caggaggccc tcaagaagga catgaacaga       180
     cacccattcg agacgacctt taccgagtgc gcgaacgtca agggcgatgt catcgagcac       240
     ctgaagaaca tcgacaagtg gacggcagac cagaaaccga gcgctggaat gctagggctc       300
     atgctcaggc caacggtgcg tccggagccg ttgggcgtcg ctcttattat tgggccctgg       360
     aatttccctt tctccctcct ggttcagccg ctgattgcgg ccatcactgc cggctgtgcg       420
     gcgttgctca aaccgtccga ggtcacatcg tcagtccaac agctgtttgt tgatctcgtg       480
     cccaagtatc tggacactag cgccgtgcgt gtcgtcactg ggggcccagc ggaaaccggt       540
     tgcctgctgc agcgcaagtt cgaccatatc ttcttcaccg gctccgttcc cgtggcgcgt       600
     catatcgctg ctgcagcggc caagcatctt acgccgactg tgctggagct gggcggacag       660
     tgtccggcta tcgtgaccag ttcggcggat gtggacgcgg cagcaaagga cattgcctgg       720
     atcaagtatc tcaatgctgg acaaatctgt ctgtccgtaa accatgtttt cgcacatcct       780
     tctgtggagc ggaagctcat tgaacgaatg gcgttctggc ttgatcggtt ctacaagggt       840
     gagaaggatg ccatgacgca catcgtcaat gacaagaact atgctcgtat caaacagctg       900
     gcggagaaga cgaagggaaa gatcgagctg gacgggacgg cagatgccga aactaggagt       960
     ctgccggtga gcatcgtgag caatgtcgaa atgagcgatc ctttgctctc cgaagagctc      1020
     tttgggaccg tctgcccggt gataaagggt tcgacagacg atgcgatcaa gtccatcaac      1080
     agcctgcccc gacccctcgc tctgtatatt ttcagtcagg accagaacga agtcgagcat      1140
     ataatatcct ccaccctctc cggtggcgtc tgtgtcaacg gcgttctcgt ccacgcaatg      1200
     gtccctaatg ccccttttgg cggagttggc gactccggtc acggcgccta ccacggcgag      1260
     tacggcttca agtccttcac ccactaccgc acaatcgccc gaccggctcc ttttttcttc      1320
     aagatgagcg aatggatgcg tcctccctac tcggtggaca acatcaagaa actggctgtc      1380
     cgcaacagtg tgggcatcca gcgcaactgg agtctagagc aggaaaggga agccattaaa      1440
     cgaggtctgc ttctcacaaa gtccctgaaa tctgccagat ttctggtcta ccttgtggtt      1500
     ttgctcggac ttgctgatgt tggtctagat cggcggttgg gtgtgcttaa aagcgtgagg      1560
     gacctgcttg tagaagttag gtctttgttt tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page