(data stored in ACNUC16935 zone)

EMBL: BN001307.PE8

BN001307.PE8         Location/Qualifiers
FT   CDS_pept        join(29725..29979,30073..30510)
FT                   /locus_tag="ANIA_09053"
FT                   /old_locus_tag="AN9053.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007800"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007800"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007800"
FT                   /db_xref="GOA:Q5ARM7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM7"
FT                   /protein_id="CBF84384.1"
FT                   /translation="MAEAIKRAEIYGIGMVSVNHSNHFGMAATYVLQALQANMISLVFT
FT                   SSAKQMPPFGGKETPLGIAPFAAGAPSNREVPYILDIAPSTPMSPQRKYGSDRRTKGLG
FT                   SGIAILMDIMSSVLTVAGFGGQVGDRYKDAKPQDAGHCFIAIKPDVCFSVDDLKARMDT
FT                   LVQRVHGVIPAPGFSEVLFPGEPEQRLCLQRRREGIPYADAERKMFTESAKQYGVPELL
FT                   LSETPLSV"
     atggccgaag cgatcaagcg ggctgagata tatggcattg gaatggtcag tgtcaatcac        60
     tctaaccact ttggtatggc ggcaacctac gtgctccagg cattgcaggc caacatgatc       120
     tcccttgtct tcaccagctc ggcgaagcag atgcctccat ttggaggaaa agagaccccc       180
     cttggcatcg cgccattcgc ggcgggggcc ccttccaaca gggaagttcc gtatatcctc       240
     gatatagccc cttctacgcc aatgtcgcct caacggaagt atggctctga tcggcggacc       300
     aaagggttag gctctggaat tgctatcttg atggatatca tgtccagtgt tttgacagtc       360
     gcggggttcg gcgggcaggt tggcgatcgg tacaaggatg cgaagccgca ggatgccggc       420
     cattgcttca ttgcgatcaa gccagatgtg tgcttcagtg tcgacgactt aaaggcacgc       480
     atggacacat tagtgcagag ggtgcatggg gttatcccgg cgccggggtt ctccgaagtc       540
     ctattccctg gcgagccaga gcagcggctg tgcctgcagc gccgaagaga gggcatcccg       600
     tacgcggacg cagagaggaa gatgtttact gagtctgcca agcaatatgg tgttcctgag       660
     ctgcttcttt ctgagacgcc tctttcggtc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page