(data stored in ACNUC16935 zone)

EMBL: BN001307.PE80

BN001307.PE80        Location/Qualifiers
FT   CDS_pept        join(220614..220760,220810..221191,221287..221404,
FT                   221590..221620,221693..221703,221733..222093)
FT                   /locus_tag="ANIA_08984"
FT                   /old_locus_tag="AN8984.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007871"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007871"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007871"
FT                   /db_xref="GOA:Q5ARU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU6"
FT                   /protein_id="CBF84517.1"
FT                   /translation="MAGDERVSITAVSWTLGTLSILLVALRLYTRLLITRCRGWDDLFV
FT                   TIALVNAIICSALTQIAVSHGLGKHEADIPNPNDRISAAKYATIAPSFSVISTVTGKIS
FT                   VVIFLLRLLTLSAKPWHRWFLHSLTLASIAWNILGIVAIIGYCRPTRKIWLPETEGSCM
FT                   SSRFQLVAGISQSAFNAFADWALALFPAILFRKVQLPLLKKVVVIAVLGSGVLDMARHH
FT                   EMVYVELRQQPKIWNEQMYLIIICASVPTMPQSLNALLHLCKTYHKYNSSSSRCNLSRP
FT                   SIREPGVLLKRMQDSSLFDAPAEHAGSQENILACNEGELNTNIGCMIDLTVAQDSDIGD
FT                   IVLVQGGTN"
     atggcgggcg atgagagagt cagcatcact gcggtgtcgt ggacactagg cacactgtcc        60
     atccttttag tcgcactacg tctctacact cgcttgctga taactagatg tcgaggatgg       120
     gacgatctgt tcgtcactat tgctttagta aacgcaatca tctgctcagc cctaacccaa       180
     atcgcagtct cccacggcct tgggaagcac gaggccgata tcccaaatcc caacgaccgc       240
     ataagcgctg ccaaatacgc cactattgca cccagcttct ccgtcatcag tacagtgact       300
     ggcaaaatct ctgtagtgat attcctcctc cgactgctaa cgttatctgc caaaccgtgg       360
     catcgatggt ttctccactc tttgacgctc gcttcaattg cgtggaatat actcgggata       420
     gttgcgatta tcggttattg tcggccgacg aggaagatat ggctgcctga aacggagggg       480
     agttgcatga gttcaagatt ccagcttgtc gctgggatat cgcaatctgc atttaacgcc       540
     ttcgctgact gggcactcgc actcttccct gcaatcttat ttcgcaaggt ccagctgccg       600
     cttttgaaga aggtagtagt catcgctgtt ttggggtctg gcgtactgga catggcgcgc       660
     catcatgaga tggtatatgt agaattgaga cagcagccta agatatggaa cgagcagatg       720
     tacctgataa taatctgcgc ctctgttccg acaatgccgc agagccttaa tgccctcctc       780
     cacctctgca agacatatca caagtacaat tccagttcgt cccgttgcaa cttgagcaga       840
     ccaagtattc gagaaccagg agtcttgctt aaacgcatgc aggacagttc attgtttgac       900
     gcacctgccg agcatgctgg gagccaggaa aatatcctcg cctgtaacga gggcgaattg       960
     aatacgaata tcggatgtat gatagacctt actgttgctc aggacagtga tataggcgac      1020
     atagttctgg tccaaggcgg aacaaattga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page