(data stored in ACNUC16935 zone)

EMBL: BN001307.PE84

BN001307.PE84        Location/Qualifiers
FT   CDS_pept        229515..230204
FT                   /locus_tag="ANIA_08980"
FT                   /old_locus_tag="AN8980.4"
FT                   /product="AlcMPredicted protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV0]"
FT                   /note="transcript_id=CADANIAT00007875"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007875"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007875"
FT                   /db_xref="GOA:Q5ARV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV0"
FT                   /protein_id="CBF84524.1"
FT                   /translation="MDDPLLRAWTTQYTNSPITTPRSATPGECRLRPPRDERVEKPRHP
FT                   KNPPTPPSMSMPYAVSSVPQGNMCNVDRGNGALEYINPSLLLFPQDYASQESNNYASAR
FT                   RVSDRRIGQSPYTRPNTPNVEGVSNVSSSDQRSSLSGRNGREEQSNPPVDIFEGILAKM
FT                   LAFDVVRPPSTNELGNDEPPREVEAKQPTVHHGFAISVGWSSTFFPDDIQEGSGHSRNT
FT                   VDTVGHF"
     atggacgacc ctttactccg cgcctggacg acgcaatata caaactcacc aatcacaaca        60
     ccacggtctg ctacacctgg agagtgccgc ctacgcccac cgcgcgacga acgcgtggag       120
     aagcctcgac accccaagaa tcctccaacc ccgccttcca tgtccatgcc ctatgctgtc       180
     agctctgtgc cccaaggaaa catgtgcaat gtggaccggg gcaacggcgc acttgagtat       240
     atcaacccga gcctgctgct atttccacaa gactatgcaa gccaagagtc caacaattat       300
     gcgagcgcaa gacgggttag tgaccgacgg attggtcagt ctccctatac gcgtcccaat       360
     acaccgaacg tggaaggtgt ctccaatgtg tcttcgtcgg atcaacggtc ctcgctgtcc       420
     gggcgcaacg ggcgagagga gcaatccaac ccgccagtag atattttcga agggattcta       480
     gcaaaaatgc tggcgtttga tgttgtgcgg ccgccgtcta cgaacgaatt aggcaatgat       540
     gagcctccgc gtgaggtgga ggcgaaacaa ccgactgtcc atcatggatt tgcaattagt       600
     gttggctggt ccagtacatt cttccccgat gacatacagg aggggtcagg gcattcgaga       660
     aataccgtgg atacagttgg gcatttctag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page