(data stored in ACNUC16935 zone)

EMBL: BN001307.PE86

BN001307.PE86        Location/Qualifiers
FT   CDS_pept        join(234657..234731,234792..237182)
FT                   /locus_tag="ANIA_08978"
FT                   /old_locus_tag="AN8978.4"
FT                   /product="Regulatory protein alcR
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P21228]"
FT                   /note="transcript_id=CADANIAT00007877"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007877"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007877"
FT                   /db_xref="GOA:P21228"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PDB:1F4S"
FT                   /db_xref="PDB:1F5E"
FT                   /db_xref="PDB:2ALC"
FT                   /db_xref="PDB:3ALC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21228"
FT                   /protein_id="CBF84528.1"
FT                   /translation="MADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRW
FT                   NKDCTFNWLSSQRSKAKGAAPRARTKKARTATTTSEPSTSAATIPTPESDNHDAPPVIN
FT                   SHDALPSWTQGLLSHPGDLFDFSHSAIPANAEDAANVQSDAPFPWDLAIPGDFSMGQQL
FT                   EKPLSPLSFQAVLLPPHSPNTDDLIRELEEQTTDPDSVTDTNSVQQVAQDGSLWSDRQS
FT                   PLLPENSLCMASDSTARRYARSTMTKNLMRIYHDSMENALSCWLTEHNCPYSDQISYLP
FT                   PKQRAEWGPNWSNRMCIRVCRLDRVSTSLRGRALSAEEDKAAARALHLAIVAFASQWTQ
FT                   HAQRGAGLNVPADIAADERSIRRNAWNEARHALQHTTGIPSFRVIFANIIFSLTQSVLD
FT                   DDEQHGMGARLDKLLENDGAPVFLETANRQLYTFRHKFARMQRRGKAFNRLPGGSVAST
FT                   FAGIFETPTPSSESPQLDPVVASEEHRSTLSLMFWLGIMFDTLSAAMYQRPLVVSDEDS
FT                   QISSASPPRRGAETPINLDCWEPPRQVPSNQEKSDVWGDLFLRTSDSLPDHESHTQISQ
FT                   PAARWPCTYEQAAAALSSATPVKVLLYRRVTQLQTLLYRGASPARLEAAIQRTLYVYNH
FT                   WTAKYQPFMQDCVANHELLPSRIQSWYVILDGHWHLAAMLLADVLESIDRDSYSDINHI
FT                   DLVTKLRLDNALAVSALARSSLRGQELDPGKASPMYRHFHDSLTEVAFLVEPWTVVLIH
FT                   SFAKAAYILLDCLDLDGQGNALAGYLQLRQNCNYCIRALQFLGRKSDMAALVAKDLERG
FT                   LNGKVDSFL"
     atggcagata cgcgccgacg ccagaatcat agctgcgatc cctgtcgcaa gggcaagcga        60
     cgctgtgatg ccccggaaaa tagaaacgag gccaatgaaa acggctgggt ttcgtgttca       120
     aattgcaagc gttggaacaa ggattgtacc ttcaattggc tctcatccca acgctccaag       180
     gcaaaagggg ctgcacctag agcgagaaca aagaaagcca ggaccgcaac aaccaccagt       240
     gaaccatcaa cttcagctgc aacaatccct acaccggaaa gtgacaatca cgatgcgcct       300
     ccagtcataa actctcacga cgcgctcccg agctggactc aggggctact ctcccacccc       360
     ggcgaccttt tcgatttcag ccactctgct attcccgcaa atgcagaaga tgcggccaac       420
     gtgcagtcag acgcaccttt tccgtgggat ctagccatcc ccggtgattt cagcatgggc       480
     caacagctcg agaaacctct cagtccgctc agttttcaag cagtccttct tccgccccat       540
     agcccgaaca cggatgacct cattcgcgag ctggaagagc agactacgga tccggactcg       600
     gttaccgata ctaatagtgt acaacaggtc gctcaagatg gatcgctatg gtctgatcgg       660
     cagtcgccgc tactgcctga gaacagtctg tgcatggcct cagacagcac agcacggcga       720
     tatgcccgtt ccacaatgac gaagaatctg atgcgaatct accacgatag tatggagaat       780
     gcactgtcct gctggctgac agagcacaat tgtccatact ccgaccagat cagctacctg       840
     ccgcccaagc agcgggcgga atggggcccg aactggtcaa acaggatgtg catccgggtg       900
     tgccggctag atcgcgtatc tacctcatta cgcgggcgcg ccctgagtgc ggaagaggac       960
     aaagccgcag cccgagccct gcatctggcg atcgtagctt ttgcgtcgca atggacgcag      1020
     catgcgcaga ggggggctgg gctaaatgtt cctgcagaca tagccgccga tgagaggtcc      1080
     atccggagga acgcctggaa tgaagcacgc catgccttgc agcacacgac agggattcca      1140
     tcattccggg ttatatttgc gaatatcatc ttttctctca cgcagagtgt gctggatgat      1200
     gatgagcagc acggtatggg tgcacgtcta gacaagctac tcgaaaatga cggtgcgccc      1260
     gtgttcctgg aaaccgcgaa ccgtcagctt tatacattcc gacataagtt tgcacgaatg      1320
     caacgccgcg gtaaggcttt caacaggctc ccgggaggat ctgtcgcatc gacattcgcc      1380
     ggtattttcg agacaccgac gccgtcgtct gaaagcccac agcttgaccc ggttgtggcc      1440
     agtgaggagc atcgcagtac attaagcctt atgttctggc tagggatcat gttcgataca      1500
     ctaagcgctg caatgtacca gcgaccactc gtggtgtcag atgaggatag ccagatatca      1560
     tcggcatctc caccaaggcg cggcgctgaa acgccgatca acctagactg ctgggagccc      1620
     ccgagacagg tcccgagcaa tcaagaaaag agcgacgtat ggggcgacct cttcctccgc      1680
     acctcggact ctctcccaga tcacgaatcc cacacacaaa tctctcagcc agcggctcga      1740
     tggccctgca cctacgaaca ggccgccgcc gctctctcct ctgcaacgcc cgtcaaagtc      1800
     ctcctctacc gccgcgtcac gcagctccaa accctcctct atcgcggcgc cagccctgcc      1860
     cgccttgaag cggccatcca gagaacgctc tacgtttata atcactggac agcgaagtac      1920
     caaccattta tgcaggactg cgttgctaac cacgagctcc tcccttcgcg catccagtct      1980
     tggtacgtca ttctagacgg tcactggcat ctagccgcga tgttgctagc ggacgttttg      2040
     gagagcatcg accgcgattc gtactctgat atcaaccaca tcgaccttgt aacaaagcta      2100
     aggctcgata atgcactagc agttagtgcc cttgcgcgct cttcactccg aggccaggag      2160
     ctggacccgg gcaaagcatc tccgatgtat cgccatttcc atgattctct gaccgaggtg      2220
     gcattcctgg tagaaccgtg gaccgtcgtt cttattcact cgtttgccaa agctgcgtat      2280
     atcttgctgg actgtttaga tctggacggc caaggaaatg cactagcggg gtacctgcag      2340
     ctgcggcaaa attgcaacta ctgcattcgg gcgctgcaat ttctgggcag gaagtcggat      2400
     atggcggcgc tggttgcgaa ggatttagag agaggtttga atgggaaagt tgacagcttt      2460
     ttgtag                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page