(data stored in ACNUC16935 zone)

EMBL: BN001307.PE88

BN001307.PE88        Location/Qualifiers
FT   CDS_pept        join(238444..239195,239252..239561)
FT                   /locus_tag="ANIA_08977"
FT                   /old_locus_tag="AN8977.4"
FT                   /product="AkePPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV3]"
FT                   /note="transcript_id=CADANIAT00007879"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007879"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007879"
FT                   /db_xref="GOA:Q5ARV3"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV3"
FT                   /protein_id="CBF84531.1"
FT                   /translation="MLFKNASFLFPLVLPLGALASSGPGNGTSGFMTFQPGFKAILGEH
FT                   PKLELLHENRTYPFAHEAPVYIPDTGDLFIVGNYQTPTGGQAIQISRMVPQKNGSYVRE
FT                   IIHPDIPMANGAINYNGGILFCDQGTKERPSSLIFMNATAPYETKVLLDSFYGRHFNSL
FT                   NDLDVHSDGSIWFTDPTYGYDQGFSMKPDLPNQVYRFNPKTGDVRVVADQIGQPNGIAF
FT                   SPDESIVYVTDTDAVWGNGDNDSTRPATIYAFDVKYYSGSPFLMNRRVFAYTDNGIPDG
FT                   VKTDTEGNVYAGCGDGVHVWSPAGVLLGKIQLPGTSANLAFAKPGEMFALNEYRLWKVT
FT                   LSQNVQGTILNEL"
     atgctcttca agaacgcctc cttccttttt cccttagtcc tgcccctagg tgccctggcg        60
     tcttcaggcc ccggaaatgg cacctcgggc ttcatgacat ttcaaccggg cttcaaggcc       120
     attctcggcg agcacccgaa acttgaactt ctccatgaaa ataggacata tcccttcgcc       180
     catgaagctc cagtctacat cccggacaca ggtgacctct tcatagtcgg caactaccag       240
     accccaacag gtggccaagc gatccaaatc tcccgcatgg ttccccagaa gaatggcagc       300
     tatgtgcgcg agatcattca ccccgacatt cccatggcca acggggctat caactacaat       360
     ggcggcattc ttttctgtga ccagggcaca aaagagcgtc cttcttccct gatcttcatg       420
     aacgcgaccg ccccctacga gaccaaagtc ctgctcgaca gcttctacgg ccgtcacttt       480
     aacagtctta acgacctcga cgtgcattca gacggcagta tctggttcac ggacccgaca       540
     tacggctacg accagggctt tagcatgaag ccggacctgc caaaccaggt ctaccgattc       600
     aatcccaaaa ccggcgacgt gcgcgtggtg gctgaccaga ttggccaacc gaatggcatt       660
     gccttctcgc cggacgagag tatcgtctat gtaaccgata ccgatgctgt ttggggaaac       720
     ggcgataatg actccaccag gcctgcgact atctacgctt ttgacgtcaa atactactcc       780
     ggttctcctt tccttatgaa ccgccgtgtc tttgcgtaca ccgataacgg catccccgac       840
     ggtgtcaaaa cggacaccga gggcaacgtg tatgccgggt gcggcgatgg agtccatgtc       900
     tggtcccccg ccggtgtgct gctgggcaaa atccagcttc ctggcacctc ggccaacctg       960
     gcgtttgcca aacctggcga gatgtttgcg ctgaacgagt accggctctg gaaggttact      1020
     ctgagccaga atgttcaggg gactattctc aatgaacttt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page