(data stored in ACNUC16935 zone)

EMBL: BN001307.PE89

BN001307.PE89        Location/Qualifiers
FT   CDS_pept        join(240294..240409,240458..240503,240535..240563,
FT                   240600..240712,240764..240999)
FT                   /locus_tag="ANIA_08976"
FT                   /old_locus_tag="AN8976.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007880"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007880"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007880"
FT                   /db_xref="GOA:Q5ARV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV4"
FT                   /protein_id="CBF84533.1"
FT                   /translation="MTYNSGQETPATHTAPRCVREPASVPVQLVEGAWGLVVRPDLPMP
FT                   DAVIFYIHSNLLLSCLLSGAFILNIWGLILVWATLRSWESYGFTEESGDRKTHDSGLVS
FT                   RQPQFIIQYPQGSLKFVSDEPNMHVAIMTFKCLTFKEYASPTELLPVRRTYRPIVESPE
FT                   AGQIPQYQQPRPQNLG"
     atgacataca actctggcca agaaaccccg gctacacata cagcgccacg ctgcgtcaga        60
     gaaccggcca gtgtcccggt tcaattggtc gagggagctt ggggtttagt cgtcagaccc       120
     gacttaccca tgccggatgc tgtgatattc tacatccata gtaacctact attatcatgt       180
     ttgctcagcg gagcttttat tctcaacatt tggggtctca ttctcgtttg ggcgactctc       240
     cggagctggg agtcttatgg cttcactgaa gagtcaggcg accgcaaaac gcacgattcg       300
     ggattagtgt ctcgtcagcc ccaatttatc attcagtatc cacaagggtc actcaaattc       360
     gtctccgacg agccgaacat gcacgttgcc atcatgacct tcaaatgctt gacgtttaag       420
     gaatatgcga gtcctaccga gctcctacct gtgcgcagga catatcgacc tattgttgaa       480
     agcccagaag ctggccaaat acctcaatac caacagccca ggccgcaaaa tctgggctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page