(data stored in ACNUC16935 zone)

EMBL: BN001307.PE9

BN001307.PE9         Location/Qualifiers
FT   CDS_pept        join(32617..32673,32730..33116,33171..33323)
FT                   /locus_tag="ANIA_09052"
FT                   /old_locus_tag="AN9052.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007801"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007801"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007801"
FT                   /db_xref="GOA:Q5ARM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM8"
FT                   /protein_id="CBF84386.1"
FT                   /translation="MRTIYITALIAFLALEAFGYPTDTDAVTEPAFPGYEDGTTTFQVV
FT                   PYPDADKITLSGTMQEVHAKILEINPIYEEDWKNVNNTYSKPEPRSDKPPLLNCDGRNG
FT                   YAKIDKINDGISYLRKFKLPPGLEGNTCQMVSCSYDSAISWCNALPTLRVLPSFDNIAD
FT                   GAQVILNWCQVDWDNVGGVLGHPDSWRVFVDKEKC"
     atgcgaacca tctacatcac cgccttaatt gcatttctag ccctggaggc ctttggttat        60
     cccacagata ccgacgccgt caccgaaccg gcctttcccg gctacgagga tggcactacg       120
     accttccaag ttgtgcccta ccccgacgcg gacaagatca cccttagcgg caccatgcag       180
     gaagtccatg ccaaaatcct cgaaatcaat ccgatctacg aggaagactg gaagaacgtc       240
     aataatacct actcaaagcc tgaaccccgg tcggacaagc ctcctctgct aaactgcgac       300
     ggacgcaatg ggtatgccaa aatcgacaaa atcaacgacg gcatcagcta ccttcgcaag       360
     ttcaagctgc caccaggcct cgaaggaaat acttgccaga tggtcagctg ctcgtatgat       420
     tcggccatca gctggtgcaa cgctcttccc accctgaggg ttctcccctc cttcgacaat       480
     atcgctgacg gtgcacaggt gattctgaac tggtgccagg tggactggga taatgtcggg       540
     ggtgtgctgg gccaccccga tagttggcgt gtttttgtgg acaaagaaaa gtgctag          597
//

If you have problems or comments...

PBIL Back to PBIL home page