(data stored in ACNUC16935 zone)

EMBL: BN001307.PE90

BN001307.PE90        Location/Qualifiers
FT   CDS_pept        242435..243289
FT                   /locus_tag="ANIA_08975"
FT                   /old_locus_tag="AN8975.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007881"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007881"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007881"
FT                   /db_xref="GOA:Q5ARV5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV5"
FT                   /protein_id="CBF84535.1"
FT                   /translation="MDQTYNPTPSAPVIRLMVLETDKPHPDTHSERGTFGKIVHEHFAT
FT                   AGRAHKPPVGVETDQVFVVSEQGGRIPSLEEFDSFDGLLITGSLYDAHGDDEWILQLLE
FT                   LLKTLWIKRADFRFLGVCFGHQLLARLLGGSIGPAPSQDWELGHCRIALTPVGQRLFRT
FT                   RGDDNHVYLHQMHQDQVKIAPTAASAGPDMLPQDTEIAVWGHTDHTPVQGLYIPNRLFT
FT                   TQAHLAFDEDMVKRQIQIRVEKGAISDLEHADRAAETADLEHDGVEVAKAILRLFMDDE
FT                   EGQ"
     atggaccaga cgtacaaccc cacgccttcg gcacccgtta tccgcctcat ggtcctcgag        60
     accgacaagc ctcatccaga cacacactcc gagcgcggca ccttcggcaa gatcgttcac       120
     gagcattttg ctaccgccgg gcgcgcccac aagccaccgg taggagtcga gacagatcag       180
     gtcttcgttg tatctgagca aggcggccgg attccaagtc tggaagagtt tgacagcttc       240
     gacgggctgc tcatcactgg aagcctgtac gacgctcacg gtgatgacga gtggatcctg       300
     cagctgctgg aacttctcaa aaccctctgg atcaaacgag cagattttcg ctttctgggc       360
     gtctgctttg gtcaccagct ccttgcccgt ttgttgggag gttcgattgg gccggcgccg       420
     tctcaggact gggagctcgg gcactgtcgc atcgcgctca cgcctgttgg gcagcgtctc       480
     ttccgcacgc gtggggacga taaccatgtc tacttgcacc agatgcacca ggatcaagta       540
     aagattgcgc caaccgcggc gtccgcagga ccagacatgt tgccgcagga tacagagatt       600
     gcagtctggg gccacactga ccatacgcct gttcaggggc tctatatccc aaaccgccta       660
     ttcaccacac aggcgcatct cgcatttgac gaggatatgg tcaagcggca gatccagatt       720
     cgggtggaga agggcgcaat ctctgatctc gaacacgcgg atcgggctgc tgagacggct       780
     gatctggagc atgatggggt tgaggttgca aaggctatac tcaggttatt catggatgat       840
     gaggagggac agtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page