(data stored in ACNUC16935 zone)

EMBL: BN001307.PE91

BN001307.PE91        Location/Qualifiers
FT   CDS_pept        complement(join(244848..245118,245171..245297,
FT                   245715..245926,246011..246075))
FT                   /locus_tag="ANIA_08974"
FT                   /old_locus_tag="AN8974.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007882"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007882"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007882"
FT                   /db_xref="GOA:Q5ARV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV6"
FT                   /protein_id="CBF84537.1"
FT                   /translation="MSNRNPVTSTESPGSLSADKRFFDEANAAFQNDGGWYNTFVPDTA
FT                   MITRAEQGSRYQGPNLEEDEGDLAAEADAAMDANPAFGSYLDEQVEGVSDRAPSTAHLE
FT                   ILDNRSRPDSKTLAMSTNNPPEEAKEGSYGFPAWDTFESQKDGYALDRRAHLDEVERGP
FT                   AVRHKNVGERDYNRASAEGQPDTQFNKSARFSPPSLKNGEGLEETWTDADLEEFRRAAG
FT                   KR"
     atgtcaaacc gaaatccagt tactagtaca gaatctcccg gttccctgag tgccgataaa        60
     cgtttcttcg acgaggccaa cgcggctttc cagaatgatg gaggctggta caatacattt       120
     gtcccggata ctgccatgat aacgcgggca gaacagggct caagatatca agggcctaat       180
     ctggaggagg acgagggcga cttggcggcc gaggcagatg ctgcaatgga cgcaaaccct       240
     gcatttggtt catacttgga tgagcaggtc gaaggagtat ctgaccgggc cccaagtacg       300
     gctcacctag agatcctaga taatcgatca agacctgact ccaaaacact tgccatgtcc       360
     accaacaacc cgccagagga ggcgaaagaa ggctcatacg gcttccccgc ttgggacaca       420
     ttcgagtctc agaaagacgg gtacgcgctt gacagaagag cacacctgga tgaggttgag       480
     cgtggtccag cggttcgcca taagaacgtg ggtgagcgcg attacaacag agcctccgct       540
     gaagggcagc cagacacaca attcaacaaa tctgcgcggt ttagccctcc atcgctcaag       600
     aacggcgagg gccttgaaga gacctggacg gatgcagact tggaggaatt tagaagagca       660
     gctgggaagc gatag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page