(data stored in ACNUC16935 zone)

EMBL: BN001307.PE93

BN001307.PE93        Location/Qualifiers
FT   CDS_pept        join(250130..250699,250915..251006,251368..251834,
FT                   251901..252262,252311..252460,252509..252813,
FT                   252880..253165)
FT                   /locus_tag="ANIA_08972"
FT                   /old_locus_tag="AN8972.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007884"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007884"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007884"
FT                   /db_xref="GOA:Q5ARV8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV8"
FT                   /protein_id="CBF84541.1"
FT                   /translation="MQSPEPQPCHLPSVTIKPAPSTSPAPIQFGEFPAHSDARTGLSKM
FT                   HDGGTYSNRPEPLAPTLGLGVDSQIQAATLCSVSSTFLCLSPGRSCSHSQILKTTVSAV
FT                   GQLGKLDDSCGMYLSREDGRMVAGVWHKESPSPFPNMAQSVLARSQPRRTWPAATVLTG
FT                   LKESLFDVGRGHDWVPRGLAPAPASGNRYLLARSSGGPPRAVLDLSASSVFVNDYYSEL
FT                   FGYDQGVTGGLLELPSFYKYFPEITADMCPEDENLSSCRSQRSTNQGIAVAAYNLGCFL
FT                   GAILTVFIGNAIGRRRTIFCGCVTMTTGAILQCTAYSLPHWIVGRIVTGIGNGMNTSTV
FT                   PTWQSESAKAHDRGKLVMIEGMLITGGICLSYWINYGFAFLPDHEVSWRFPIAFQIIFA
FT                   VTIFISIMNLPESPRWLVMKGRDDEAVEILELLNEKPRDDPYIQNELLSIKETVMEMNK
FT                   GSFRSLFKMSEYREFHRVALAYVNQMFQQISGINLITYYAPNIYTDIGLGGGNTAKLMA
FT                   AANGTEYLLAAFIPIFIIEKVGRRPLMLFGAAGMSISMAILAGTHYRRETYDDTKAGVA
FT                   QAVFLFVFNTFFAIGWLGMTWLYPAEIVPLRIRAPTNALSTSANWIFNFMVVMITPVAF
FT                   ENIKHNTYTIFAVINAFMFPVVYFCFPETRYRSLEEMDAIFKKSDGIWSAVQHSIKEPY
FT                   RYDKHGQLKPEYLEEAIRRESVRHVEGKFESEDSTNESQEAKGTETRLE"
     atgcaaagcc cagagcctca accgtgccat ttgccgagcg tcactatcaa gccggcacct        60
     tctactagcc cggccccgat ccagtttgga gaatttccgg ctcattccga tgctcggacg       120
     ggtttgagta agatgcacga tggggggacc tactccaatc gccccgagcc cttggcgccg       180
     accttagggc ttggcgttga ctcacagatc caggcggcga cgctgtgctc agtctcgagc       240
     actttccttt gtctcagccc tggacgatca tgcagccaca gtcaaatttt gaaaacgacc       300
     gtctcagcgg ttggccaact tgggaagctc gatgatagct gcggcatgta cctgagccgc       360
     gaagacggca ggatggtggc cggtgtgtgg cataaggaat cccctagtcc tttcccgaac       420
     atggcccaat ccgtattggc cagatctcag ccacggcgta cttggcccgc agccaccgtt       480
     ctcactggct tgaaggaaag tctttttgac gtaggccggg gacatgactg ggtcccgcgg       540
     gggttggcgc ctgccccagc ttctggtaac cgatatctgt tagctcgctc ctctggtggg       600
     ccgccaaggg cagttcttga cctctcggcc tcaagcgttt ttgttaacga ttattactca       660
     gagcttttcg gttatgacca aggcgtcaca ggcggtctcc tcgagctgcc atccttctac       720
     aagtacttcc cggaaatcac tgcagacatg tgcccggaag acgaaaacct cagctcctgc       780
     aggtcgcagc gtagcaccaa ccagggcatc gctgtcgccg catacaacct cggctgcttt       840
     ctcggagcta tcttgaccgt gttcatcggt aacgcaatcg gccgtcgcag gaccattttc       900
     tgcggctgcg tgactatgac tactggcgct atcctgcaat gcactgctta cagcctccct       960
     cattggatcg ttggacgaat cgtgactgga atcggtaacg gcatgaacac cagtacggtt      1020
     ccaacctggc agtcagagtc tgcgaaagcg cacgatcgtg gtaaactggt gatgatcgag      1080
     ggtatgttga tcaccggcgg aatttgtctc agctactgga tcaactatgg tttcgccttc      1140
     cttcccgacc acgaggtctc atggcgcttc ccaatcgcct ttcagattat tttcgccgtt      1200
     actatcttca tatcaattat gaacctcccc gagtcccctc gttggctggt tatgaaaggt      1260
     cgggacgacg aagcggttga gattcttgaa ctcctgaacg agaagccgcg cgacgaccct      1320
     tacatccaga acgaactgct gtcaatcaag gaaactgtga tggaaatgaa caagggatca      1380
     ttccgcagcc tgttcaagat gagcgagtac cgtgaattcc accgtgtcgc gctcgcctac      1440
     gtcaatcaga tgttccagca gatttccggc atcaacctca tcacttacta tgctcccaat      1500
     atctacacgg acattggtct cggtggcggt aacaccgcga agctcatggc cgccgccaac      1560
     ggcaccgagt acctcctcgc cgcgttcatt cccattttca ttatcgagaa agtcggccgt      1620
     cgcccgttga tgctctttgg cgctgctgga atgtctatct ccatggccat tctcgcgggt      1680
     acacactacc gccgcgaaac ctacgacgac accaaggccg gtgtggccca ggcagtcttc      1740
     ctctttgttt tcaacacctt cttcgccatc ggttggctcg gcatgacctg gctgtatccc      1800
     gccgagatcg tcccgctccg tatccgtgcg cctaccaatg cgctgtcgac ttcggcgaac      1860
     tggatcttca acttcatggt ggtcatgatc acccctgttg cctttgagaa catcaaacat      1920
     aacacgtaca caatctttgc ggtcattaat gcttttatgt tccccgtcgt ctacttctgc      1980
     ttccccgaaa cccgttaccg ttcgctcgaa gagatggacg caatcttcaa aaagtcggac      2040
     ggaatctgga gcgctgtgca gcattctatc aaggagccgt accgctatga taaacacggt      2100
     cagcttaagc ctgagtacct cgaggaggcg atcaggcgag aaagtgtgcg tcatgtggag      2160
     ggcaagttcg agagtgagga cagcaccaat gagagtcagg aggcgaaggg gacggagacg      2220
     agactggagt aa                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page