(data stored in ACNUC16935 zone)

EMBL: BN001307.PE94

BN001307.PE94        Location/Qualifiers
FT   CDS_pept        join(258411..258957,259029..259146,259215..259781,
FT                   259904..259943)
FT                   /locus_tag="ANIA_08971"
FT                   /old_locus_tag="AN8971.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G13725)"
FT                   /note="transcript_id=CADANIAT00007885"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007885"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007885"
FT                   /db_xref="GOA:Q5ARV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV9"
FT                   /protein_id="CBF84542.1"
FT                   /translation="MLESEPGLVVDHGWVLYAASWPLFGICFLIISLRLWVRAHMVRSL
FT                   GWDDAFMILAFLCAAINTILVTISVQYGTGRHASNLTEYQQSQSIKYQVLSAGFHVMST
FT                   NWGKVSVALFLIRIISEVKNHKLGMYALIIVMTIINTGAVITIFAQCQPTAAIWDHSLA
FT                   GPQACWPPDTQKKYSFFQAAASALTDLILAIYPLFTIKDLQMPTKVKLGLGFVLSLGLV
FT                   AMVAAIIKATHLPDMASYEDYTWDTINLTIWVSLEQYLIILAACIPALTPLFNIIVRRA
FT                   SNRSKSKSKSMPNDLLKGDSVTVQSLSRKHKHGSRSRGRSRDFALTLDSNSSQHQQYNP
FT                   FARVGREYVEYPLTWTTTTMHTATDLHHPADGSDSETPISGFHEEPEMPTGILRTTDFR
FT                   LEAVSNSRNSAVRWQIAKPILQDN"
     atgctcgagt cagagccggg gcttgtcgtc gaccacggct gggtcctcta cgccgcctcc        60
     tggccgctat ttggcatctg cttcctgatc atctccctcc gcctctgggt tcgcgcgcac       120
     atggtccgct cccttggctg ggacgacgcg ttcatgatcc tcgcgtttct ctgtgcagcg       180
     atcaacacca tactcgtcac aatcagtgtt caatatggca ccggccggca cgcctctaac       240
     ctcactgaat accaacagag ccagtcaata aaataccagg ttctgtcggc cgggttccat       300
     gtcatgagca ccaactgggg caaggtttct gtggcattat tcttaatacg gattatctca       360
     gaggtcaaga accataagct ggggatgtat gcgctcatta tcgtcatgac cataatcaat       420
     accggtgccg tcataacgat cttcgcccaa tgccagccga cagcggcgat ctgggaccac       480
     agccttgctg ggccacaggc ttgctggccc ccagatacgc agaagaagta ttctttcttt       540
     caggctgctg catcagcgct taccgacctt atcctcgcga tataccccct cttcacaatc       600
     aaagatctcc aaatgccaac caaagtcaag ctcggcttag gatttgtcct atcgctcggc       660
     ctcgttgcaa tggtggccgc gatcattaaa gcaacgcacc ttcccgacat ggcctcttac       720
     gaagactata cctgggacac cataaacctc acaatctggg tctcactcga acagtatctc       780
     atcatcctag ccgcgtgcat cccagccctg acgcccctgt tcaatatcat cgtccgccgc       840
     gcctccaaca gatcgaaatc aaaatccaaa tcaatgccga atgatttgct taagggtgat       900
     agtgttacag tacaaagctt atcacgcaag cataaacacg gcagccgaag cagaggccgt       960
     agcagagact tcgcactgac actcgactcc aacagctcac agcaccagca atacaaccca      1020
     tttgcaagag taggaagaga gtacgtcgag tatccgctta cctggacgac aacgacgatg      1080
     cacactgcga cggatttgca ccatcctgcg gatgggagtg acagtgaaac accgatttca      1140
     gggtttcatg aagagcctga gatgccgacg gggattctgc gcacgacgga ttttcgtctc      1200
     gaggctgttt cgaactctag gaattccgct gtgcggtggc agattgctaa acccatccta      1260
     caggataact aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page