(data stored in ACNUC16935 zone)

EMBL: BN001307.PE96

BN001307.PE96        Location/Qualifiers
FT   CDS_pept        join(262359..262493,262549..263064)
FT                   /locus_tag="ANIA_08969"
FT                   /old_locus_tag="AN8969.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007887"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007887"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007887"
FT                   /db_xref="GOA:Q5ARW1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW1"
FT                   /protein_id="CBF84546.1"
FT                   /translation="MKFISVLALPGLAYAAVQGFDISHYQETVDYQGAYDSGARFVMIK
FT                   ATEGTSYTDPKFSTHYSGATSAGLIRGGYHFAQPGSSSGADQASYFIEHGGGWSGDGQT
FT                   LPGMLDLEAGCYGLSTSAMSSWIKDFGETYKAATGRYPMIYTTTSWWQECTGNDSGFGE
FT                   YPLVVARWGSSVGTLPASWSTHSFWQNADTYEFGGDSEVWNGSEDSLKTFASK"
     atgaagttca tctccgttct cgctctcccc ggcctggcct acgccgctgt gcaaggcttc        60
     gatatctccc actatcagga aactgtcgac taccagggtg cctacgactc tggagcgcgc       120
     ttcgtcatga tcaaggctac cgagggaaca agctacactg atcccaagtt cagcacgcac       180
     tactcgggcg ccacgtccgc aggtctaatc cgcggcggat accacttcgc gcaaccaggc       240
     tcgtcctccg gagccgacca ggcatcttac ttcatcgagc acggcggtgg atggtccggc       300
     gacggacaaa cgctccctgg catgctggac cttgaagccg gctgttacgg cctttcaact       360
     tcggccatgt cctcctggat caaggatttc ggcgagactt acaaggccgc cacgggccgg       420
     taccccatga tctacacgac tactagctgg tggcaggagt gcacgggcaa tgacagcggt       480
     ttcggcgagt acccgcttgt tgtggcgcgc tggggaagca gtgttggtac tctgccagcg       540
     agctggagta ctcattcctt ctggcagaat gctgacactt atgagtttgg cggggactca       600
     gaggtctgga atggcagtga ggacagcttg aagacttttg cttcaaaatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page