(data stored in ACNUC16935 zone)

EMBL: BN001307.PE97

BN001307.PE97        Location/Qualifiers
FT   CDS_pept        join(263269..263494,263571..263934,264012..264360)
FT                   /locus_tag="ANIA_08968"
FT                   /old_locus_tag="AN8968.4"
FT                   /product="isoflavone reductase family protein
FT                   (AFU_orthologue; AFUA_1G12510)"
FT                   /note="transcript_id=CADANIAT00007888"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007888"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007888"
FT                   /db_xref="GOA:C8VL85"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL85"
FT                   /protein_id="CBF84548.1"
FT                   /translation="MTKSNLLIFGATGAIGSYITAAITDARDEFGRIGIFTSQSTLTKK
FT                   TKEINALREKAVDILVGDVTSKDEVLKAFDGFDTVVSALGRGVIAQQVHLVQWADESPQ
FT                   IKRFLPSEYGTDIEYSLASANEKPHQQKLKVRAAIRETKNLEYAFVVTGPYADVPFYLG
FT                   ASKNPRGGSFDVKNKKAVLLGDGNGRISLVACADVGKFVVHTLTHWDKARGRALKLNSF
FT                   TTTPNDILAEFEKQTGNKWSVEYTSLKQLKQYEKEAWEKGEPDATTLTLRRIWTEGGTL
FT                   YERRDNEDIGAENTTTLEEAVNGAIKTQLGQ"
     atgaccaaat ctaaccttct tatcttcggc gccaccggcg caattggctc ctacatcacc        60
     gccgcaatca cagacgcgcg agacgaattc ggccgaatcg gcatcttcac gagccagagc       120
     acactcacta agaaaacgaa agagatcaat gcactgcgcg aaaaggctgt cgatatcctt       180
     gttggtgacg tcacgagcaa ggatgaagtg ctaaaggctt ttgatgggtt cgacaccgtt       240
     gtatcagccc tcggccgcgg cgtaatagca cagcaggtgc atttggttca atgggccgac       300
     gaatcgcctc agataaaacg atttctcccc tccgagtatg gcactgacat tgagtattcc       360
     ctcgcgtccg caaacgaaaa gccgcaccag cagaagctca aagtacgcgc tgcgatccgc       420
     gaaacgaaga atttggagta tgcgttcgtg gtcacgggcc cgtacgctga tgttccgttt       480
     tatcttggag cttccaagaa cccccgcggc gggagctttg atgtcaagaa taagaaggct       540
     gttctgcttg gggatgggaa cgggaggatc agcttggttg cttgcgctga tgtcggtaaa       600
     ttcgtcgtgc ataccttaac gcattgggac aaagcacgcg gccgagcgct gaagcttaac       660
     tcgttcacga cgacgccgaa tgatatctta gctgaattcg aaaagcagac aggcaataaa       720
     tggagcgtcg agtatacatc cttgaaacaa ttgaagcagt acgagaagga agcgtgggag       780
     aagggtgagc ctgatgcgac gaccctaacg ctcaggcgga tctggacaga gggaggaacg       840
     ctttatgagc gcagggataa tgaggatatt ggagcggaga acactaccac tttggaggag       900
     gctgtcaacg gggctattaa gacgcaactc ggacagtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page