(data stored in ACNUC16935 zone)

EMBL: BN001307.PE98

BN001307.PE98        Location/Qualifiers
FT   CDS_pept        complement(264455..265948)
FT                   /locus_tag="ANIA_08967"
FT                   /old_locus_tag="AN8967.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G14300)"
FT                   /note="transcript_id=CADANIAT00007889"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007889"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007889"
FT                   /db_xref="GOA:Q5ARW3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW3"
FT                   /protein_id="CBF84550.1"
FT                   /translation="MGLEQHKTAVTRIASAIRGFYERKQPFRIAHGSTNSTRPIRRKHE
FT                   VDISDLRNVLRVDPVTRTALVEPNVPMDRLVEATLKHGLVPPVVMEFPGITAGGGFAGT
FT                   AGESSSFRYGFFDRTINYVEMVLADGSIVKVSENENRDLFRGAAGAVGSLGVTTLMELQ
FT                   LVEAKKFVKATYLPQRSVRDSITNVHAATLNDANDYVDGIIYGPDHGVVVAGEMTNEMP
FT                   DSAKIQTFSKAWDPWYYLHVKAKTRGNSPVTDYIPLAEYLFRYDRGGFWVGRAAFHYFH
FT                   FPFSRVTRWWLDDFLHTRMLYKALHASGESSRFVIQDLALPYANAEKFINYTSNKLGIW
FT                   PLWLCPLKQSPAPTFHPHSSVQSPGFTEDQMLNIGVWGFGPKDPEAFVTANRELEHRLR
FT                   ELGGMKWFYAHTYYGEDEFWSMYDRKWYDELREKYNATTLPSVYDKIKIDVEADRKERH
FT                   ESWSRKVRSIWPLGGLWGIKKAIESKEYHIHRNSTWKWK"
     atggggctcg agcaacacaa aaccgccgtt acacgtatcg cctcggccat tcgcggcttc        60
     tacgagcgca agcagccgtt tcgcattgcg cacggctcga cgaacagcac ccgcccgatc       120
     cgccggaagc acgaagtcga catttcagac cttcgcaatg tcctccgcgt cgatccggtc       180
     acacgtaccg cactcgtcga acccaatgtc cccatggacc gccttgtcga ggcaacgctg       240
     aaacacgggc tcgtgccgcc ggtcgtcatg gagttccctg gtatcacagc gggagggggc       300
     tttgcgggaa cagcaggaga gagcagcagc tttcggtatg ggttcttcga ccgcactatc       360
     aactatgtgg agatggtgct ggcggatggg agtattgtca aagtgtccga gaacgagaat       420
     cgggacttgt ttcgtggtgc tgcaggcgcg gttggaagct tgggtgtcac gacgctgatg       480
     gagctgcagc ttgtggaggc gaagaagttc gtcaaggcga cgtatctccc acagcggagt       540
     gtgcgggact ctattaccaa tgtccacgcc gcgacgctga acgatgcgaa tgactacgtt       600
     gatggaatca tatacggccc cgaccacggc gttgtcgtcg ccggcgagat gacgaatgag       660
     atgcccgata gcgcaaaaat tcagacattt agcaaggcgt gggacccgtg gtactatcta       720
     catgttaagg ccaagacgcg cggcaactcg cccgtcacag actatatccc gctggcggag       780
     tatctgttcc ggtacgaccg aggcgggttt tgggttggcc gggcggcgtt ccactacttc       840
     catttcccgt tcagccgggt gactcggtgg tggctggatg acttcttgca cacgcgcatg       900
     ctctataaag cgctccatgc gagtggggaa tccagccgct tcgtcattca ggatctagcg       960
     ctaccgtatg caaacgccga gaaatttatc aactatacca gcaataagct aggcatctgg      1020
     ccgctctggc tgtgtccgtt gaaacagagt ccagcgccaa ccttccaccc tcactcatcc      1080
     gtgcaaagcc ccggcttcac cgaagatcaa atgctcaata tcggcgtgtg gggattcggc      1140
     ccgaaagacc cggaggcttt cgtgactgcg aaccgagagc tagaacatcg actccgcgaa      1200
     ctgggtggga tgaagtggtt ctacgcccat acgtattacg gagaagacga gttctggagt      1260
     atgtatgacc ggaaatggta cgacgagctg cgggagaagt ataacgccac cactcttccg      1320
     agtgtgtatg ataagatcaa gatcgatgtg gaggcggatc gtaaggaacg tcacgagtct      1380
     tggagccgca aggtgcgctc gatctggccg cttggtggac tttggggaat caagaaggcg      1440
     attgaaagta aggagtatca tatccataga aattccacct ggaagtggaa gtaa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page