(data stored in ACNUC16935 zone)

EMBL: BN001307.PE99

BN001307.PE99        Location/Qualifiers
FT   CDS_pept        complement(join(268531..268632,268738..269073,
FT                   269124..270713))
FT                   /locus_tag="ANIA_08966"
FT                   /old_locus_tag="AN8966.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007890"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007890"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007890"
FT                   /db_xref="GOA:C8VL87"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL87"
FT                   /protein_id="CBF84552.1"
FT                   /translation="MVLAQYLKRAVAWLAPPPKQSEDGRDQWPSRAAFLLAAMGGCAGQ
FT                   GNLIRYPSVVYNNYGLQWFIPYFLAIFFVAIPALILEISIGQAYRGGTVIAFNNINRRL
FT                   KGVGIGPILVSFIVTQYFTVNLAWIMNYFRNSFRSPLPWEGRIEEFYMGDVIHNVDPVG
FT                   GELSTDGKHVLSYTEYPGVRLLGETVGWSAFIWFLIWVSIFRGVGLTGRVVYWTMGLPI
FT                   VTTIIFVGRSLSLENASEGVKLLWATWRGGQLASGTVWQTAVGQVFFSTGIGFGYFTSY
FT                   ASYNAKHSNAVMDALLICGSNVLFENFAAFAVFGVVGYLHRWPEDGVRLGAFVVGFLTL
FT                   PEAVLHMPGSNFWAILLFFTLVVLGFSSAFVMLDAVATLVVDSGLKVSRPIIVTVLTLI
FT                   SFLMCLPYCTEFGFYLLDGIDRWINNICLIFVVWSEVVSASTVYRWQDVVDQTGLPAFI
FT                   TYNFAYFGGQVIGVSVAHGTENPGIGAGAGFGVYVVFSILSALLAKTPIQPAPSFWGRN
FT                   SLLSRFWYLAAYSGNQIRRDLNAIIGGEKNWKIPSVWPVLLRYVCAPVLAIIFSFAYPE
FT                   FHTLRYDPLMITGFILAHILLLIILLGLVMPRYYDVFIPPNRIDEGGRLRADLANDRII
FT                   PGGSDDGKCDNCASAPRQSGHEVAPIFLVEHLAPTYETCL"
     atggtgttgg ctcagtatct aaagagagcc gtagcctggc tcgctccacc cccaaaacaa        60
     tctgaggatg gacgggacca atggccctcc cgcgcagcct tccttctcgc tgcgatgggc       120
     ggatgcgcag gacagggaaa cttgatccgg tacccgtcag tcgtatacaa caactacggg       180
     ctgcagtggt ttataccgta cttcttagcg atcttcttcg ttgccatccc cgcgcttatc       240
     ctcgagatca gcattggtca ggcctaccgc ggcggaacag tgatcgcatt caacaatatc       300
     aatcgccgtc ttaaaggtgt gggcattgga cctattctgg tgagcttcat cgtcacgcag       360
     tatttcacgg tgaatctggc ctggattatg aattacttcc ggaatagttt tcggtctcca       420
     cttccttggg agggccgaat cgaggagttt tacatgggcg atgtaatcca caatgttgat       480
     cctgtgggcg gggagttgag tacggacggc aaacacgttc tttcgtacac ggagtacccc       540
     ggcgtccggc ttttggggga aacagttggc tggagtgcct tcatctggtt tctcatctgg       600
     gtgtccattt ttcgaggcgt gggcctaacc ggccgagtcg tctactggac aatgggcctc       660
     cccatcgtca cgacaatcat cttcgttggc cgctctctat cccttgaaaa cgcgtctgag       720
     ggcgtcaagt tactctgggc aacctggcgc ggcggacaac tcgcctcggg aaccgtctgg       780
     caaacagccg tgggccaggt tttcttctcg acgggtatcg gattcggcta tttcacctct       840
     tatgcgtcct acaacgcgaa acacagcaac gcggttatgg acgcactgct tatatgtggg       900
     agtaacgtgc tctttgagaa ttttgccgca tttgcggttt tcggtgtggt tggataccta       960
     caccgctggc cggaggatgg tgtgcgactc ggtgcatttg tggtaggttt cttgacgctt      1020
     cctgaggcgg ttctgcatat gcctgggtcg aacttctggg ctatcttgct gttcttcacc      1080
     ctcgttgtgt tagggtttag ttctgcattc gtcatgcttg atgccgtggc tacacttgtc      1140
     gttgatagcg ggcttaaggt ctcaaggccc atcattgtga cggttctgac acttatctcg      1200
     ttcctcatgt gtcttcccta ctgcacggaa ttcggatttt atcttcttga cggaatcgat      1260
     cgttggatta acaatatctg tttgatcttc gttgtctggt ctgaggttgt tagcgcaagc      1320
     actgtctacc gctggcagga cgttgtggac cagactggtc ttccagcatt catcacgtac      1380
     aactttgcct acttcggtgg acaggttatt ggagtgtctg tggcgcatgg taccgagaac      1440
     cccggaattg gcgcaggcgc cggattcggg gtctacgtcg tcttctcgat cctttcggct      1500
     ctccttgcta aaacaccgat tcaaccggcc ccgagcttct gggggagaaa ctcattactc      1560
     agtcggttct ggtatcttgc tgcatactcg ggcaaccaaa ttcgccgcga tttgaatgcc      1620
     atcatcggtg gggaaaagaa ttggaagatc ccctctgtgt ggcccgtcct gctccgctac      1680
     gtatgcgcgc ctgtgctcgc gatcatcttc agtttcgcgt accctgagtt ccacaccctg      1740
     cgctacgacc cgctcatgat cacgggattc atccttgcgc atattcttct tctcattatt      1800
     ctgctcgggt tggtgatgcc gaggtactat gatgttttca taccgcccaa ccggattgat      1860
     gagggcggga ggcttagggc ggatctggcg aatgaccgga ttatccctgg gggttcagat      1920
     gatgggaaat gtgacaactg tgccagtgct ccccgacaat ccggccatga agtagcgcct      1980
     atcttcctcg ttgagcactt ggcacctacg tatgaaactt gtctctaa                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page