(data stored in ACNUC16935 zone)

EMBL: BN001307.PLKA

BN001307.PLKA        Location/Qualifiers
FT   CDS_pept        join(1123585..1123911,1123966..1124408,1124473..1127104)
FT                   /gene="plkA"
FT                   /locus_tag="ANIA_01560"
FT                   /old_locus_tag="AN1560.4"
FT                   /product="Polo-like kinase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q874A0]"
FT                   /note="transcript_id=CADANIAT00008189"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008189"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008189"
FT                   /db_xref="GOA:C8VMZ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ9"
FT                   /protein_id="CBF85111.1"
FT                   /translation="MERHLQPTMEALSPRSTNQMIKPKASMERKVLDKNAAAAQKASSA
FT                   KNHAPPPPALVVEPGDDGEQYSTGAFLGKGGFAICYEGTLLRNGRVFAMKVVKSDMGQK
FT                   KMQEKFRTELQIHSKMRHPHIVGFHRAFVYDQCIYVILELCPNGSVMDMVRKRKCLSLP
FT                   EVRRFMVQLCGAVKYLHKRNVAHRDLKMGNLFLDRNMDIKVGDFGLAAMIMSEKDEKRR
FT                   KTLCGTPNYIAPEVLDRSKGGHTQKVDIWSLGVICFAMLTGYPPFQSKTQEEIYKKVRN
FT                   LTYVWPKDSECANHIPDEAKSLVSCCLNLDEQKRPEPDDIVEHAFFNMYNGCIPKRLDP
FT                   KCSVQKPTWLRGAEPQGDAMAFGHGLDFDEKFSSYIRDVDDPILRYRTCKAAFYSSCGV
FT                   GRKPDGTARKSVGHNASKSGFAECLAEEEKGLQPLMPLPEDMVYKYPHDLIGDWSVPES
FT                   LPLRRQDALADTSVLSSRSSSTSLRTNTVSQSRTQAALAAAQQRRNGSQSHAASLRQQA
FT                   LTGRGTIRKIPSLCDPPQPTMKAMPDVRDAGLNPDPVPPVPTGGLAERPIRTRRGIAAS
FT                   YSGTTSVRGMDTNAVPSVSQASNDLGMLTVGKTRSQSRKLEAANQVAVEPLRVLKDRST
FT                   STGPENLAAVSRQKSARTVHKDLGGVAARKPDSEAARREEPVTRQRTEAQPQPMSSSGS
FT                   KASLSSTNKPRSSLGLHALLHSDDPCELLPGSSIDDVKIDLRNMLSNLVPGSAARRRVV
FT                   SQRPPHAYVIKWVDYTNRYGIGYVLDDGSVGCVFKAENGQPASGVVLRDGEKHIRRKAR
FT                   SQENSDSQSWSYSEADQLVPRHGKPVEFYENCSDDLLECRGGICRALIPPSLFEVKDSS
FT                   GGVKVRMDSGISRARADAEKIKRVKLVDQFGKYMIGSLGRHGDETLLDDAATDGAPGQF
FT                   IKFYQRLGNVGVWGFGDGAFQFNFPDHTKLVLAPGRTRNSSPWMDFYHLSPTAARYLAA
FT                   KGKMHPSGFDTRAVVSDEIATFLSIAYGTSTSAMDDKIREVLDANSFLQKIAFIKDVLK
FT                   SWIRQGRLGGRPSSDKPGTEMFWEGSQERPQASGGGSSKFVWVTVGAPGGDGEYRSVSL
FT                   RDKKGNSVGENDEMEALRERLRLAGL"
     atggagagac acctccaacc aacaatggaa gctctatcgc cgcggtcaac aaaccagatg        60
     ataaaaccga aagcatctat ggagcgaaaa gtcctagata agaatgcagc tgcggcccag       120
     aaagcttcat cagcaaagaa ccatgcgccg cccccaccag cgctagtcgt ggagcccgga       180
     gacgacgggg agcaatactc aaccggtgct ttcctcggca agggggggtt tgctatttgc       240
     tatgaaggga ctctgttgcg caacggtcgt gtctttgcaa tgaaagtcgt aaagtctgac       300
     atgggccaga aaaagatgca agagaagttt cgaacagagc tgcagataca ctcaaaaatg       360
     cgtcaccctc acatagtcgg ctttcaccgg gcattcgttt acgaccagtg catatacgtg       420
     atattagagt tatgtcccaa tggatcagtg atggacatgg tgcgaaaaag gaaatgcttg       480
     agtttgccgg aagttcgacg attcatggtc caactctgcg gtgccgtaaa atacctccac       540
     aagcggaatg ttgcgcatcg tgacttgaag atgggcaact tgttcttgga ccgcaacatg       600
     gacatcaagg tcggagattt tggattggca gccatgatta tgtcggaaaa ggacgagaag       660
     cggaggaaga cgttatgcgg aacacccaac tacattgcgc cagaagttct cgacagaagc       720
     aagggaggcc atactcagaa agtggatatt tggtccctgg gagtgatctg ttttgcaatg       780
     cttacgggat atccaccatt ccagtcaaag acccaagaag aaatatataa gaaagtgcga       840
     aatcttacat acgtctggcc aaaagactcg gagtgcgcga accacatccc tgacgaagct       900
     aagtcattgg ttagctgttg cctcaacctc gatgaacaga aacgtccgga gccggacgat       960
     attgttgagc atgcattctt caacatgtac aatggatgta tacctaaacg gctagatcca      1020
     aagtgcagcg tccaaaaacc aacttggctc agaggggccg agccgcaagg cgatgccatg      1080
     gcttttggcc atggcctaga ttttgacgag aaattctcga gttacatcag agatgtagat      1140
     gatcctatct tacgctatcg gacctgcaaa gcagcattct acagctcttg tggtgtaggg      1200
     aggaaaccag atggaactgc gcgaaaatct gttggacaca atgcctcaaa atcaggattt      1260
     gccgagtgtc ttgcggagga agagaagggc ctccagccat tgatgcccct tcccgaagac      1320
     atggtctaca agtaccctca tgatctgatc ggcgattgga gcgtccctga atcgctgccc      1380
     ctgagaagac aagacgcttt agcggatacc agcgttcttt ctagcagaag cagtagcaca      1440
     tcattgcgaa caaatacggt atctcaatcg agaacgcagg ctgctcttgc cgcggctcaa      1500
     cagcggcgga atggttcgca gagccacgcg gcatccttac gacagcaagc gttaacaggc      1560
     agaggtacca taagaaaaat accctcactg tgcgacccac cacaaccgac tatgaaagcc      1620
     atgcctgatg tgcgagacgc tgggcttaac ccggaccccg taccgcctgt gcctactgga      1680
     gggttagctg agcgtccaat tcgaactcga cgaggcatag cggcatcata ttcgggcaca      1740
     acctcagtcc ggggtatgga tactaatgct gtaccttcag tgtcccaagc aagcaatgat      1800
     ctgggaatgt tgacggtggg aaagacgcga tctcaatcac gtaaattgga agctgcgaat      1860
     caagtagctg tcgaacccct tcgcgtgcta aaggatcggt ctacatctac aggcccagaa      1920
     aacttggccg cggtctcgcg acagaagtct gcacgaacag ttcacaagga tttgggaggc      1980
     gtcgcagcta ggaagcctga ttctgaagcg gcgcggaggg aggagcctgt cacacgccaa      2040
     cgaacggaag cccagcctca acccatgagt agctctggaa gcaaagcttc gctgtcatcc      2100
     accaacaagc caaggtcgag tctcgggctg cacgccctgc ttcactcaga tgatccttgt      2160
     gaattactac cgggatcatc gattgatgat gttaaaatag acctacggaa catgctctct      2220
     aacttggttc ctggttcggc ggcccgacga agagtcgtat cgcaacggcc gccgcatgcg      2280
     tatgtcatca agtgggtgga ctatacgaac cggtacggga tcggctatgt gctggacgat      2340
     ggtagtgttg gctgtgtgtt caaagccgag aatggccagc cggcgagcgg cgtagttctt      2400
     cgagatgggg aaaagcacat tcgtcgcaag gctcgcagcc aagagaactc cgattcccag      2460
     tcatggtcat attctgaagc tgatcaactt gtgcctcgtc acggaaaacc agtggagttt      2520
     tacgagaact gtagcgacga tctcctcgaa tgccgtggcg gtatctgtag ggcgttgata      2580
     ccaccgtctt tgttcgaggt aaaagactct tccgggggtg tcaaggttcg aatggattct      2640
     gggattagcc gcgcacgcgc agacgccgaa aaaatcaagc gcgtcaagct cgttgaccag      2700
     tttggaaagt acatgatcgg atcccttggt cgacatggcg acgagacgtt gctcgacgac      2760
     gcggcaaccg acggagcccc tggacaattt attaaattct accagagact aggcaatgtg      2820
     ggtgtctggg ggttcggaga tggggctttc cagtttaact tcccagatca cacaaagctg      2880
     gtcctggcac ctggtcgtac gaggaactca tcaccgtgga tggacttcta ccatctctca      2940
     cctactgcag cgcgttacct cgcagcgaaa ggcaagatgc acccgtctgg attcgacacc      3000
     cgagcggtgg tatcagacga aatagccacg ttcctcagca ttgcttacgg tacaagcact      3060
     agcgccatgg acgataaaat cagggaggtt ttggatgcga attcgttcct ccagaagatc      3120
     gccttcatca aagatgttct caaaagctgg atccgtcaag gacgattggg agggcggcct      3180
     tcgtcagaca aaccgggtac tgagatgttc tgggagggtt cgcaggagcg acctcaagca      3240
     agcggcggtg gcagtagcaa atttgtatgg gtgacagtgg gcgcgcctgg aggcgatggg      3300
     gagtatcgct cggtgtcgct tagagacaag aaaggtaaca gtgttggaga gaacgacgag      3360
     atggaggcgc tcagggaacg actgcgatta gcgggcttat aa                         3402
//

If you have problems or comments...

PBIL Back to PBIL home page