(data stored in ACNUC8465 zone)

HOGENOMDNA: BURA4_4

ID   BURA4_4; SV 1; empty ; DNA; empty ; PRO; 1127947 BP.
XX
AC   NC_010557;
XX
PR   Project: 58701;
XX
DE   Burkholderia ambifaria MC40-6 chromosome 3, complete sequence.
XX
OS   Burkholderia ambifaria MC40-6
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1127947
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L., Lang,D.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Lykidis,A.,
RA   Ramette,A., Konstantinidis,K., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of chromosome3 of Burkholderia ambifaria MC40-6";
RL   Unpublished
XX
RN   [2]
RP   1-1127947
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (04-APR-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1127947
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L., Lang,D.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Lykidis,A.,
RA   Ramette,A., Konstantinidis,K., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (02-APR-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001027.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002673
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1127947
FT                   /strain="MC40-6"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia ambifaria MC40-6"
FT                   /chromosome="3"
FT                   /db_xref="taxon:398577"
FT   gene            39..851
FT                   /db_xref="GeneID:6181994"
FT                   /locus_tag="BamMC406_5516"
FT   CDS_pept        39..851
FT                   /locus_tag="BamMC406_5516"
FT                   /gene_family="HOG000161261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bam:Bamb_5749
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:172064801"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:6181994"
FT                   /translation="MLRTREEFRRIRSSCSVPCMKVCGNAARASFFRRHGPVGGRHRNG
FT                   MAQAAKGKTVRGTGVREAAAQETRDKILHAATKVFARYGYEGGSVERISRLAKSYDRMI
FT                   YYYYGSKEGLFVAVLEGIYRRMDEAELKMAPDASNPVEALKSVIRFKLDYYWRNPDFIT
FT                   LLNTENLHKGKHLSKLERRGEYSSHAVEIIAKILENGVEQGLFRTGLRARDVFLLIIST
FT                   AYFYTSNLYTLSAFLGEELNAPDAVRHWETFVIDSVLRVVRKDASIDA"
FT                   /protein_id="YP_001815513.1"
FT   misc_feature    174..>497
FT                   /note="HTH-type transcriptional regulator RutR;
FT                   Provisional; Region: PRK15008"
FT                   /db_xref="CDD:184970"
FT                   /locus_tag="BamMC406_5516"
FT   misc_feature    252..392
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="BamMC406_5516"
FT   gene            909..1763
FT                   /db_xref="GeneID:6181973"
FT                   /locus_tag="BamMC406_5517"
FT   CDS_pept        909..1763
FT                   /locus_tag="BamMC406_5517"
FT                   /gene_family="HOG000244729" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bam:Bamb_5750 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="GI:172064802"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="GeneID:6181973"
FT                   /translation="MNYLRAHTIDEVLGRLAAQPRPHIVCGATDAFADIGLVPARSAWV
FT                   DISRVNALRVIDQHDGMIRIGAASTWDAIARTTWLPVALTAAAACIGPRQIRVQGTIGG
FT                   NVCHASPVADGIPALLALDARVELASLRGVRRLPLAEFLLGNGRTALHADELLVAVLLA
FT                   PPHTHDRTSFIKCTNRDGSAIAVVSAAAQLRVGADGTADAVAVAIGGTSDVARRMPALE
FT                   AALAGRRLDELAGAIAAAPLAELSPVDDCRATASHRIHLARLAVTRAFTCCIEENARGA
FT                   STA"
FT                   /protein_id="YP_001815514.1"
FT   misc_feature    909..1715
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM homologs [Energy production and
FT                   conversion]; Region: CoxM; COG1319"
FT                   /db_xref="CDD:31510"
FT                   /locus_tag="BamMC406_5517"
FT   misc_feature    909..1394
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="BamMC406_5517"
FT   gene            1744..4566
FT                   /db_xref="GeneID:6181974"
FT                   /locus_tag="BamMC406_5518"
FT   CDS_pept        1744..4566
FT                   /locus_tag="BamMC406_5518"
FT                   /gene_family="HOG000244715" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; ferredoxin; [2Fe-2S]-binding domain
FT                   protein; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bam:Bamb_5751 aldehyde oxidase
FT                   and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="GI:172064803"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="GeneID:6181974"
FT                   /translation="MAHPLPDQLADVRETIAGGSTPVSPEPDWFELNGTRRSLPADHSQ
FT                   RLIDHLRADLRQFGTKEGCRQGDCGSCTVIVDGDARYACLIPVGQIAGRRVVTVEGLAD
FT                   GTRCGGRLQHAFLAHQAVQCGFCTPGMLTAAAAAIDAGEVSDRASARAAIDGVLCRCTG
FT                   YQKIVDAVTEAGCGGAARCVTPAPSEGPSVGVPLTRLDGPEKVDGSQRFGADGYPADSL
FT                   FLRAVRSPHHRARFAFGDLDAFVRAHPGVHRVLTHADVPGMNLHGVATPYMDQPVLPET
FT                   EARHHLEAVALVVGERAAIAALDLDCFPVNWESLTPVLAIADAVLDDSPLLHADRPGNV
FT                   LIEGHVRRGEPERAMQDARHVVSATFESSFVEHAYLEPEAGWARRVGDIIEIHSSTQAP
FT                   HPHRADLARILAVAPEQVRVVATAVGGGFGGKLDMTVQPLLAIAAWHLDRPVAMVLSRE
FT                   ESMATSTKRHPGRMTSSMAADADGRLHAVTFDADFNTGAFASWGTAVANRVPVHAGGPY
FT                   VIPHYAARARAIHTHVTAAGAFRGFGVPQTTMSQEQLIDELAFTAGIDPLEFRAMNALR
FT                   PGDTLPTGQVLDDSVGLVACLDALRPAWRDAHARVATLNAAAPGHLRHGVGVAAFFYGC
FT                   GNTALPNPSTVRFGIRPDGTIVLHQGAVDAGQGANTVIPQIAADALGVPVDRLHFVGPD
FT                   TSVTPDCGRTSASRQTFITGRAAFLAGTTLRHRLLAFAGASSDARISADARGVAVDGEV
FT                   LDLRALPVDAHGYVIAAEESFDPPTTSLDASGQGSPYATYAFGAQMAEVAVDCDSGRVR
FT                   VLKVVAAHDVGKMVNPTLLEGQIEGAVAQGIGMALMEKYHPGRYNNLHDYLIPTVHDMP
FT                   DVQSIFIEAPTAVGPYGAKGIGEPALVPTAAAILNAIHHATGVRIRQAPATPDVVRVAL
FT                   AAHNSPSARR"
FT                   /protein_id="YP_001815515.1"
FT   misc_feature    1831..4464
FT                   /note="selenium-dependent molybdenum hydroxylase 1; Region:
FT                   Se_dep_Molyb_1; TIGR03311"
FT                   /db_xref="CDD:132354"
FT                   /locus_tag="BamMC406_5518"
FT   misc_feature    2035..2262
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="BamMC406_5518"
FT   misc_feature    2386..2658
FT                   /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
FT                   hammerhead domain; Region: Ald_Xan_dh_C; pfam01315"
FT                   /db_xref="CDD:144787"
FT                   /locus_tag="BamMC406_5518"
FT   misc_feature    2740..4356
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="BamMC406_5518"
FT   gene            4595..5872
FT                   /db_xref="GeneID:6181975"
FT                   /locus_tag="BamMC406_5519"
FT   CDS_pept        4595..5872
FT                   /locus_tag="BamMC406_5519"
FT                   /gene_family="HOG000136135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bam:Bamb_5752 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="GI:172064804"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:6181975"
FT                   /translation="MTPTRNVEEVSLRAGSGSSWYAELDPAGKRAFKASFAGWATDAFD
FT                   FMVFSFVLASLIDLWGLDRGKAGLLSTVTLIFSSVGGWIAGILADRYGRVKVLQGTILW
FT                   FSVCTLAIGFAQNFEQIFVLRALQGLGFGGEWAVGAVLIGEIVAPAHRGKAVGLVQSGW
FT                   AIGWGCAAILYSIAFSVLPESLAWRSLFWVGIVPALLVLYIRKHVPEPDVFVQADAARK
FT                   HGASQPSVWAIFSRSQVRRTVLAALLCTGIQGGFYAMSTWLPAFLKIERHLSVLNTSAY
FT                   LFVIIVGSFCGYVVGAYLSDFWGRRRNFMLFSALSLVSVCLYLTLPLSNAQMLWLGFPL
FT                   GFSSCGIFSGVGAYLTELYPSNFRANAQSFTYNFGRGIGALFPSLVGVLSHSLGLALAI
FT                   AIFSGAAYGVVLLAVLLLPETKARSL"
FT                   /protein_id="YP_001815516.1"
FT   misc_feature    4658..5743
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BamMC406_5519"
FT   misc_feature    4700..5743
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BamMC406_5519"
FT   misc_feature    order(4730..4732,4739..4747,4751..4756,4805..4807,
FT                   4814..4819,4826..4828,4838..4843,4847..4852,4988..4993,
FT                   5000..5005,5012..5017,5024..5026,5060..5065,5072..5077,
FT                   5093..5095,5351..5353,5360..5365,5372..5377,5384..5386,
FT                   5426..5428,5438..5440,5450..5452,5459..5461,5471..5473,
FT                   5615..5617,5624..5629,5636..5638,5648..5653,5660..5662,
FT                   5693..5698,5705..5710,5717..5722,5729..5731)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BamMC406_5519"
FT   gene            complement(5945..6724)
FT                   /db_xref="GeneID:6181976"
FT                   /locus_tag="BamMC406_5520"
FT   CDS_pept        complement(5945..6724)
FT                   /locus_tag="BamMC406_5520"
FT                   /gene_family="HOG000055568" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_5753 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:172064805"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:6181976"
FT                   /translation="MTSPTELLDASVAAWHESIDAFCRLQDGGFVERGAHGTKAFYSGA
FT                   PVSVLNAVISMTRRPDVDEIRLLSDAFSTCAVPWSIQTRDSNTHADEIARIADDHGLTQ
FT                   RVPLPFMTKRLARTAAPANSDGHVVVRRVTAEDSERYNGALAAGYEAPEGVFRRLSAPA
FT                   VLEADGMMGFWVEVDGVPVATSFGVVRNAQVGVFNVSTLPAYRRRGYARAATHAVLDAA
FT                   FESGAHTAFLHCTPAGRHVYESMGFTTGEEWQVYSGG"
FT                   /protein_id="YP_001815517.1"
FT   gene            complement(6875..10396)
FT                   /db_xref="GeneID:6181977"
FT                   /locus_tag="BamMC406_5521"
FT   CDS_pept        complement(6875..10396)
FT                   /locus_tag="BamMC406_5521"
FT                   /gene_family="HOG000282801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate carboxylase"
FT                   /transl_table="11"
FT                   /note="biotin-containing enzyme that catalyzes a two step
FT                   carboxylation of pyruvate to oxaloacetate"
FT                   /db_xref="GI:172064806"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="GeneID:6181977"
FT                   /translation="MAAVMLTPIQSILIANRSEISIRVMRAAAELNIRTVAIYSKEDRL
FT                   ALHRFKADESYLIGEGKKPLAAYLDIDDILRVARQAKVDAIHPGYGFLSENPEFAQAVI
FT                   DAGIRWIGPSPDVMRTLGNKVAARNAAIAAGVPVMPATAPLPDDFDACKVLAAEVGYPL
FT                   MLKASWGGGGRGMRVLENAQDLETLLPVARREALAAFGNDEVYVEKLVRNARHVEVQVL
FT                   GDLHGTVVHLYERDCTVQRRNQKVVERAPAPYLDRESRHALCESALRLMRAVGYTHAGT
FT                   VEFLMDADTGQFYFIEVNPRIQVEHTVTEMVTGIDIVKAQIRITEGGRIGLAEDATDAG
FT                   GALVARAAGVPEQQAIPLNGNALQCRITTEDPENDFLPDYGRLTAYRSAAGFGVRLDAG
FT                   TAYGGAVITPYYDSLLVKVTTWAPTAAESIHRMDRALREFRIRGVTSNLQFLENVINHP
FT                   AFIAGEVTTRFIDKTPELLAFAKRGDRATKLLRYLGELNVNGNAEMNGRALPALPLPKP
FT                   VLPKLDTAVAIPAGTRDRLRELGPEKFARWMLDQKQVLLTDTTMRDAHQSLFATRMRTA
FT                   DMLPIAPFYARELSQLFSLECWGGATFDVALRFLKEDPWERLALLRERVPNILFQMLLR
FT                   GSNAVGYTNYADNVVRFFVQQAASAGVDVFRVFDSLNWVRNMRVAIDAVGESGMLCEGA
FT                   ICYTGDLFDTSRSKYDLKYYVGIARELQQAGVHVLGIKDMAGICRPKAVATLVKALKEE
FT                   TGLPVHFHTHDTSGIAAASVLAAVEAGCDAVDGALDAMSGLTSQPNLSSIAAALAGGER
FT                   DPGLDADRLHEASMYWEGVRRYYAPFESEIRAGTADVYRHEMPGGQYTNLREQARSLGI
FT                   DHRWTEVSRAYADVNRLFGDIVKVTPTSKVVGDMALMMVANDLSVDDVRNPDKDLAFPE
FT                   SVVSLFKGELGFPPDGFPAELSRKVLKSEPPAPYRPGDQIPPVDFDAVRTQAEAACEQS
FT                   LDDRQLASYLMYPKQTVDYYAHVRAYSDTSVVPTPAFLYGLQPQEEVAIDIEPGKTLLV
FT                   SLQGQHADAQDGIVKVLFELNGQSRSALVEQKTVVQAGKERHGLQRADPANPLHVAAPM
FT                   PGSVVTVAVQPGQRVTAGTTLLALEAMKMETHIAAERDCEIAAVHVKPGERVAAKDLLI
FT                   ELKDPTQ"
FT                   /protein_id="YP_001815518.1"
FT   misc_feature    complement(6887..10384)
FT                   /note="pyruvate carboxylase; Reviewed; Region: PRK12999"
FT                   /db_xref="CDD:183835"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(10043..10372)
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(9416..9994)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(8984..9307)
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(7883..8731)
FT                   /note="Pyruvate carboxylase and Transcarboxylase 5S,
FT                   carboxyltransferase domain; Region: DRE_TIM_PC_TC_5S;
FT                   cd07937"
FT                   /db_xref="CDD:163675"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(order(8006..8008,8108..8110,8114..8116,
FT                   8201..8203,8309..8311,8492..8494,8498..8500,8597..8599,
FT                   8609..8611,8699..8701,8708..8713))
FT                   /note="active site"
FT                   /db_xref="CDD:163675"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(order(8609..8611,8708..8713))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:163675"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(order(8108..8110,8114..8116,8201..8203,
FT                   8708..8710))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163675"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(order(7931..7933,7973..7975,7991..7993,
FT                   8021..8023,8027..8032,8072..8077,8087..8089,8093..8095,
FT                   8099..8101,8174..8176,8180..8182))
FT                   /note="homodimer binding site; other site"
FT                   /db_xref="CDD:163675"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(7253..7852)
FT                   /note="Conserved carboxylase domain; Region: PYC_OADA;
FT                   pfam02436"
FT                   /db_xref="CDD:145532"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(6893..7093)
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(order(6968..6970,6989..6997,7022..7024))
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="BamMC406_5521"
FT   misc_feature    complement(6992..6994)
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="BamMC406_5521"
FT   gene            complement(10628..10774)
FT                   /db_xref="GeneID:6181978"
FT                   /locus_tag="BamMC406_5522"
FT                   /pseudo
FT   gene            11683..13338
FT                   /db_xref="GeneID:6182420"
FT                   /locus_tag="BamMC406_5523"
FT   CDS_pept        11683..13338
FT                   /locus_tag="BamMC406_5523"
FT                   /gene_family="HOG000229998" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bam:Bamb_5763 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:172064807"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:6182420"
FT                   /translation="MDDFCRANLPPAEDWPTFVFELPGLQFPPFLNCAAALLDTAVEER
FT                   GWGDRIAIKTESGIAWSYRELRDAGNRIANMLVRDAGLVAGNRVLLHGTNHPMLAAAWF
FT                   GVVKAGGVAVATMPKLRAGELSTIIARARVTHVICEAGLSTELDGAMASVQWRGEVRRY
FT                   ETDDTHPHARWLDGYSAEFAAADTRADDPCLIAFTSGTTGEPKATVHFHRDVMAACHCF
FT                   PEHVLRPTADDVFCGSPPLAFTFGLGALLLFPISVGASVVLLPKASPERLLAAVDRHRV
FT                   STLFTAPAAYRSMLDHLDRHDVSSLRKCVSAGEALPSWTRDAWQERTGLHLIDGIGSTE
FT                   MLHIFASTGDTGAKDGAIGKAVPGYRLAVVDEHGQCLPPYEIGYLAVQGPTGCRYLNDT
FT                   RQRDYVKHGWNLTGDSAYLDEDGYLFYQARADDMIISSGYTVSPGEVEQALLRHPDIAE
FT                   CGVVGQIDERGGTLICAHVVLRPGVDGSEALTMQLQQHVKSVIAPYKCPHRIAYHACSL
FT                   PRNESGKLRRAVLRQASHGVTRPLNQAVQNEHTL"
FT                   /protein_id="YP_001815519.1"
FT   misc_feature    11773..13290
FT                   /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
FT                   [Lipid metabolism]; Region: Acs; COG0365"
FT                   /db_xref="CDD:30714"
FT                   /locus_tag="BamMC406_5523"
FT   misc_feature    <12202..13278
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="BamMC406_5523"
FT   gene            13335..14222
FT                   /db_xref="GeneID:6181979"
FT                   /locus_tag="BamMC406_5524"
FT   CDS_pept        13335..14222
FT                   /locus_tag="BamMC406_5524"
FT                   /gene_family="HOG000250089" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5764 hypothetical protein"
FT                   /db_xref="GI:172064808"
FT                   /db_xref="GeneID:6181979"
FT                   /translation="MKILGAAVAIPDSATTAQSCANDYAIKAARQALLQAGCLPSELDL
FT                   IVSLSISPSRMADAPTIAGPRLAHPVQRDLRARHAAVFDLLDADWTLALDLAQSHCKQL
FT                   GYRRALVVRAEALADVEQVATSGFADGAGAIVLTPAGHDRVYASRYADLESPPFATLDA
FT                   LPARRVNGILSLARFESRFDHAAGRFDAEPANAATALRAMVDAVQSRIDRRVATLFCES
FT                   WLSGWPSIVTGVGRDFHVDVVSGSTDIPNPFQLPAWLASRVAHSRSLRDDEHTVVAMTL
FT                   DPFRPRIACSTMEI"
FT                   /protein_id="YP_001815520.1"
FT   misc_feature    13401..>13778
FT                   /note="3-oxoacyl-[acyl-carrier-protein]; Region: FabH;
FT                   COG0332"
FT                   /db_xref="CDD:30680"
FT                   /locus_tag="BamMC406_5524"
FT   misc_feature    13401..>13583
FT                   /note="Condensing enzymes; Family of enzymes that catalyze
FT                   a (decarboxylating or non-decarboxylating) Claisen-like
FT                   condensation reaction. Members are share strong structural
FT                   similarity, and are involved in the synthesis and
FT                   degradation of fatty acids, and the...; Region:
FT                   cond_enzymes; cl09938"
FT                   /db_xref="CDD:158792"
FT                   /locus_tag="BamMC406_5524"
FT   gene            14222..15328
FT                   /db_xref="GeneID:6181980"
FT                   /locus_tag="BamMC406_5525"
FT   CDS_pept        14222..15328
FT                   /locus_tag="BamMC406_5525"
FT                   /gene_family="HOG000247669" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; KEGG:
FT                   bam:Bamb_5765 3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="GI:172064809"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:6181980"
FT                   /translation="MVHNVRIASLACRLPARQVPNDDPVFAGVEPIPSEWWQFWGIESR
FT                   YMIDPDAGESELALAERTARDALARAGVEAAELDLVLFNMTSPFVSLADGRRRFAPRLA
FT                   RALRDRLGATRALDADVEMECASFVLQLQIATNLIKQGRVKRALVCSSERMSAVVDYTS
FT                   KSSTNFGDGAAAAVLVAEPADPDGADWLDAAYHSDATRYDLVTMQWRNARAAADDAATD
FT                   ADNPFGVYFTLKPEAQEAISRFMPVAIPDIVERLLHRSGTGIADIDAMVFHQPSALLVR
FT                   AWAQRLGLKPDQYVIRVADCACLVSAAVPFALYESIREGVIRPGSLVVIAGAGAGWGFG
FT                   AQLWRWGETVVTDAGDTVAAVTEQEVRT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815521.1"
FT   misc_feature    14228..15259
FT                   /note="3-oxoacyl-[acyl-carrier-protein]; Region: FabH;
FT                   COG0332"
FT                   /db_xref="CDD:30680"
FT                   /locus_tag="BamMC406_5525"
FT   misc_feature    14231..15211
FT                   /note="Condensing enzymes; Family of enzymes that catalyze
FT                   a (decarboxylating or non-decarboxylating) Claisen-like
FT                   condensation reaction. Members are share strong structural
FT                   similarity, and are involved in the synthesis and
FT                   degradation of fatty acids, and the...; Region:
FT                   cond_enzymes; cl09938"
FT                   /db_xref="CDD:158792"
FT                   /locus_tag="BamMC406_5525"
FT   misc_feature    order(14594..14596,15128..15130)
FT                   /note="active site"
FT                   /db_xref="CDD:73194"
FT                   /locus_tag="BamMC406_5525"
FT   gene            15325..16323
FT                   /db_xref="GeneID:6181981"
FT                   /locus_tag="BamMC406_5526"
FT   CDS_pept        15325..16323
FT                   /locus_tag="BamMC406_5526"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="FabH; beta-ketoacyl-acyl carrier protein synthase
FT                   III; catalyzes the condensation of acetyl-CoA with
FT                   malonyl-ACP to initiate cycles of fatty acid elongation;
FT                   differs from 3-oxoacyl-(acyl carrier protein) synthase I
FT                   and II in that it utilizes CoA thioesters as primers rather
FT                   than acyl-ACPs; in Pseudomonas this protein is involved in
FT                   quinolone signal biosynthesis"
FT                   /db_xref="GI:172064810"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:6181981"
FT                   /translation="MTARLVIAGMGHALPDRIVSNDEVAGMIDTSDAFIRERTGVVARR
FT                   YLAPDQHLADLACPAAERAMADAGVTARDVDLLIVNTLSPDHHDPSQACYIQPRLGLRE
FT                   IPCFDIRAQCSGGLYGIEIARHFLASGLYRNVLLICAEALSRRIDSSNAGRNLSILLSD
FT                   GAAALLLQATDHPAHGLIDLTLGADGTQFDLLSTEAPGARRPRFIDADDIAAGRHHFRM
FT                   KGRPMFEDATRRIVDACRQMLAKHRLTIGDIGLVVPHQPNLRILDAVIGQLGLPRERCM
FT                   ISVDQLGNMASAAFPVALAIAREQGRMPAGQINLLVTYGAGATWACALYRS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815522.1"
FT   misc_feature    15325..16317
FT                   /note="3-oxoacyl-(acyl carrier protein) synthase III;
FT                   Reviewed; Region: PRK12879"
FT                   /db_xref="CDD:183809"
FT                   /locus_tag="BamMC406_5526"
FT   misc_feature    15334..16314
FT                   /note="Ketoacyl-acyl carrier protein synthase III (KASIII)
FT                   initiates the elongation in type II fatty acid synthase
FT                   systems. It is found in bacteria and plants. Elongation of
FT                   fatty acids in the type II systems occurs by Claisen
FT                   condensation of malonyl-acyl...; Region: KAS_III; cd00830"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="BamMC406_5526"
FT   misc_feature    order(15571..15573,15577..15579,15604..15606,15613..15615,
FT                   15637..15657,15679..15681,15688..15693,15700..15705,
FT                   15760..15762,15877..15894,15910..15915,16288..16290)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="BamMC406_5526"
FT   misc_feature    order(15664..15666,16099..16101,16189..16191)
FT                   /note="active site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="BamMC406_5526"
FT   misc_feature    16108..16110
FT                   /note="CoA binding pocket; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="BamMC406_5526"
FT   gene            16329..17225
FT                   /db_xref="GeneID:6181982"
FT                   /locus_tag="BamMC406_5527"
FT   CDS_pept        16329..17225
FT                   /locus_tag="BamMC406_5527"
FT                   /gene_family="HOG000250090" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bam:Bamb_5767 beta-lactamase domain protein"
FT                   /db_xref="GI:172064811"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="GeneID:6181982"
FT                   /translation="MLNASPGWIDQRLALVGTADVPLYVIVNDEAATLIEGGLSGMTEL
FT                   VWQQLHDLLRDFGGIRHLRYWLITHSHYDHCSLLMTLKSRMPWLHVSGSPDAFDAFQSP
FT                   SACRTIRQLDAQASRSWDPAVGVDFTELSDLPFYPVNPDTQLDIGDGMQIRTIALPGHS
FT                   RCQFGYYCPQLDIGFVSDALGEFQGATSWLPLVFQDLFAYRHTLDVIEQLQAPRLALGH
FT                   HGILTGELARSAVRHARACLDAREADARAVRGNATATHELAHHWTARYAARSERVVPHF
FT                   LHLKSMMHMIDLFHRAE"
FT                   /protein_id="YP_001815523.1"
FT   misc_feature    16398..16994
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="BamMC406_5527"
FT   gene            17315..21133
FT                   /db_xref="GeneID:6181983"
FT                   /locus_tag="BamMC406_5528"
FT   CDS_pept        17315..21133
FT                   /locus_tag="BamMC406_5528"
FT                   /gene_family="HOG000250091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; acyl-CoA
FT                   dehydrogenase domain protein; phosphopantetheine-binding;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_5768
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:172064812"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:6181983"
FT                   /translation="MTTATSPTTLSELLQNRAATLGDKTAYVFLSGPPEQEQAESMTFA
FT                   ELDARARRVAALLQQNAIDIGDRVLLLCRPGLDYVSAFMGCLYAGAIAVPAYPPRNRQH
FT                   MVRIAGIVENAGANTILCSAEDHARCATWLADTDASGSTLLDVGGAQALDPVPSPASVQ
FT                   PSRIAFLQYTSGTTGSPKGVMVSHGNLMHNLGLMREWLAYDEQSTIVSWLPPYHDMGLI
FT                   GVILTSLYGGFRSVLMAPERFIQHPYLWLRAISQYRADLTGAPDFAYRMCCRRISDEQL
FT                   ATLDLSCVRVAYNGAESVRASTLTDFAQRFAAAGFPADGFLPCYGLAEGTLYVAGRAKQ
FT                   HPIRTLCVDQAALQRQSVVLRREFLGVSPQPLDRPGERVLVSVGRTDGEQHVIVRDLET
FT                   NERCADRTIGEICVAGPSVAAGYWHLDEQTHSTFQHSLAGHRDQVFMRTGDLGFILGDE
FT                   LYVTGRLKDMVILAGRNYYSEDIEYALIVGVPELVPNGCAAFMDDQVDAERLIVVAEVE
FT                   RTQRKGNLDSFIDAIRQAIWNRLDIGPSAIVLVSPGSVPKTSSGKVRRSTCRTQLHDGA
FT                   LTILAQWDVEGGVHTPAPDRRQPARPTAVADQPAANDRRRDESTTVDELNDWLRHYART
FT                   RIDSRTMDERRTIPPHVVLDFGNRGLLGMPIDRSHGGLGLGQRDMLRVFAQLAAIDSTL
FT                   AFFVALNNTLGILPIMQHAQPPLREELLPSLASGRMLAAFAITEPAAGSHVRAIASRAQ
FT                   RTGSGDWLVTGNKRWSGSSAWAGIINVFARQADGTGMVGLAVRPGTPGVRIGAEELTMG
FT                   VRGMIQNSLHLDRARISDAYRLGDIGQGMLVAQHAMNIARLGIAAVCVGGMKRCAQLMH
FT                   RYGGRRQVGTGLLLDNPLSRLRLGELRDRIDGLNALVEHLATELDLGVALPEDCLLISK
FT                   ILGSELLSQSADEMMQFLGGRGYIETNLAPQIFRDARLTRIFEGPTETLLVHLGSRLLN
FT                   GSDDLLRYLESALSAGALARELRELGAQLAQDGLANASKLDGTAHAAVWANYWLGTIAQ
FT                   WGLLLAVTERAAAQQRIGDGTLRWAQSQYELAIEAAQRQVGLRSALSTTVELNEWAARI
FT                   GFEIGSIEQTIPGASQLVDPLLDANADPRSVSRAPDAPAGEDAGSAATPIVSEPASLLD
FT                   RQQIHAVEQWLIAWLGERLKHRKIRLTRESTFAEIGFDSILAVEMTIVFSETFSVTVDP
FT                   SAVWDYPSIRALAAHLAPRTHGAAPAVAVAHADSDASSSIAAQPSTL"
FT                   /protein_id="YP_001815524.1"
FT   misc_feature    17333..>19138
FT                   /note="peptide synthase; Validated; Region: PRK05691"
FT                   /db_xref="CDD:180205"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    <18533..18784
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    <18653..19021
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    19163..20278
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    19193..19501
FT                   /note="Acyl-CoA dehydrogenase, N-terminal domain; Region:
FT                   Acyl-CoA_dh_N; pfam02771"
FT                   /db_xref="CDD:145756"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    19424..20266
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    order(19424..19426,19514..19516,19520..19522,19616..19618,
FT                   19622..19624,20225..20233,20237..20239,20243..20245)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BamMC406_5528"
FT   misc_feature    20795..21040
FT                   /note="Phosphopantetheine attachment site; Region:
FT                   PP-binding; cl09936"
FT                   /db_xref="CDD:186876"
FT                   /locus_tag="BamMC406_5528"
FT   gene            21145..23283
FT                   /db_xref="GeneID:6181984"
FT                   /locus_tag="BamMC406_5529"
FT   CDS_pept        21145..23283
FT                   /locus_tag="BamMC406_5529"
FT                   /gene_family="HOG000250092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5769 hypothetical protein"
FT                   /db_xref="GI:172064813"
FT                   /db_xref="GeneID:6181984"
FT                   /translation="MHARFDLGDSTTALARQLEHYLDAYPDETRTLLGLSAGTTIGVEV
FT                   LDMELPVKLEQHTHAATLRIGRHDAQRVMAYTRSCNWANGIVLVPTLARLVFAGAFRGL
FT                   RAGAPRAMRAFAKSRQPDPTRNLGVLWGALNLLSLAGWLTLDRGDEDAEYALTPAGEYV
FT                   VACVEHTRPLFEQLASATSVLQHLHALCHRTRIAADDSALYAQLARICIAGWPELPIPA
FT                   TDLERQVNGQLRTAMDGLLLGPTWVALDMPVFDRQPDGQYTQSAPGILGKLDQQPEGVA
FT                   VGAWTQADPVVLHAAWALMCKFGMAEIDREKVRLTEAGRIHRPIAAPYAGLPASYLRSY
FT                   ALLDELLFRNPDPLDIDSDGHIDRVMNVYASSGAGSGPASQEITTKILRQLFDDTPLDR
FT                   QPAGIADMGCGDGSALKRLAEYVITSTRRGRHLAAYPLLVIGADYNESARGRAAATLSA
FT                   LRDISGVQVRVIAADISQPDRYDEAVAESGLTVRQPDGSVRPAQLSDLLHTFMFLVHNR
FT                   RLSIRRKDAAEAILERHLRTVDRARLRAVIDQHYAGVLTVSDQAELPIALDQIKLAFKV
FT                   AYSDAEGLVPGYVAAADLIDFLTRWKRHAKHGFLIVEGHSPWAENLCARAPGGPDTWLR
FT                   TEQLPSVFNWGMHFVSRQFMAPFNEFTLALTLAGLRPDTPIYGRIHPEGFPAPDLLSDY
FT                   RFFSIANYVADAGNAVSG"
FT                   /protein_id="YP_001815525.1"
FT   gene            complement(23463..24317)
FT                   /db_xref="GeneID:6181985"
FT                   /locus_tag="BamMC406_5530"
FT   CDS_pept        complement(23463..24317)
FT                   /locus_tag="BamMC406_5530"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bam:Bamb_5770 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="GI:172064814"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="GeneID:6181985"
FT                   /translation="MAIETVGVVGAGTMGNGIAQTAAVAGLNVVMIDVTDAALDKGVAA
FT                   LKGSLERLVSKEKLDAGARDAALARITTSTDYAKLAAVDIVIEAATENVELKSRILKQI
FT                   EAVARPDAIIATNTSSISITALAALLAEPSRFVGMHFFNPVPLMPLVEIIRGLQTSDAT
FT                   ASAVRALTERFDKSPIGVRNAPGFVVNRILVPMINEAFFVLAEGIASAEEIDAGMKLGA
FT                   NHPIGPLALADLVGLDVCLAVMDVFLKDFGDTKYRACPLLREMVSAGRLGRKTGRGVYD
FT                   YSA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815526.1"
FT   misc_feature    complement(23472..24317)
FT                   /note="3-hydroxybutyryl-CoA dehydrogenase; Validated;
FT                   Region: PRK05808"
FT                   /db_xref="CDD:180269"
FT                   /locus_tag="BamMC406_5530"
FT   misc_feature    complement(23766..24305)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="BamMC406_5530"
FT   misc_feature    complement(23472..23762)
FT                   /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   Region: 3HCDH; pfam00725"
FT                   /db_xref="CDD:109769"
FT                   /locus_tag="BamMC406_5530"
FT   gene            complement(24356..25549)
FT                   /db_xref="GeneID:6181986"
FT                   /locus_tag="BamMC406_5531"
FT   CDS_pept        complement(24356..25549)
FT                   /locus_tag="BamMC406_5531"
FT                   /gene_family="HOG000012240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-ketothiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="catalyzes the formation of beta-ketovaleryl-CoA from
FT                   acetyl-CoA and propionyl-CoA"
FT                   /db_xref="GI:172064815"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:6181986"
FT                   /translation="MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVSEVLSRA
FT                   NVSGDAVGHVVFGHVVNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAA
FT                   QTIMLGDADIAIGGGSESMSRAPYTVPAARFGQRMGDAKLVDMMLGALHDPFQTIHMGV
FT                   TAENVARKYGISRDAQDALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEH
FT                   VRHDAGPDDFSKLKPVFVKEDGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLV
FT                   AYAHAGVDPAYMGIGPVPATQKALERAGLKITDLDVIEANEAFAAQACAVTQELGLDPA
FT                   KVNPNGSGISLGHPIGATGALITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815527.1"
FT   misc_feature    complement(24359..25540)
FT                   /note="beta-ketothiolase; Provisional; Region: PRK09051"
FT                   /db_xref="CDD:181625"
FT                   /locus_tag="BamMC406_5531"
FT   misc_feature    complement(24362..25525)
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BamMC406_5531"
FT   misc_feature    complement(order(24389..24394,24629..24631,24689..24691,
FT                   24695..24697,24701..24703,25178..25180,25223..25225,
FT                   25232..25237,25256..25258,25280..25291,25322..25324,
FT                   25334..25336,25343..25345,25388..25390,25469..25471))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BamMC406_5531"
FT   misc_feature    complement(order(24401..24403,24491..24493,25271..25273))
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BamMC406_5531"
FT   gene            complement(25597..27270)
FT                   /db_xref="GeneID:6181987"
FT                   /locus_tag="BamMC406_5532"
FT   CDS_pept        complement(25597..27270)
FT                   /locus_tag="BamMC406_5532"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; KEGG: bur:Bcep18194_C6873
FT                   electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="GI:172064816"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="GeneID:6181987"
FT                   /translation="MTTQDLLAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGT
FT                   EIGVCVLEKGSEIGAHILSGAVMDPRAINELFPDWKERGAPLDVAVTEDRFLFLSETGA
FT                   VTTPNWALPANFQNHGNYVISLGNVTRWLGAQAEALGVEIFPGFPAAEILYNDDGSVKG
FT                   VATGNMGVGKDGEPTENFQLGMELHAKYTLFAEGCRGHLGRQLISKFKLDANADPQAYG
FT                   IGIKELWEIDPAKHKPGLVIHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPY
FT                   LSPFEEFQRYKTHPSIRAFLEGGKRVSYGARAITAGGLLSLPKTVFPGGALIGDDAGFL
FT                   NASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQSWLYTELYRARNFKQ
FT                   WMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCTPIEYPKPDGKLTFD
FT                   RLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEARFCPAAVYEFVKNDDGGD
FT                   RLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815528.1"
FT   misc_feature    complement(25861..27228)
FT                   /note="Dehydrogenases (flavoproteins) [Energy production
FT                   and conversion]; Region: FixC; COG0644"
FT                   /db_xref="CDD:30989"
FT                   /locus_tag="BamMC406_5532"
FT   misc_feature    complement(<26254..27222)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="BamMC406_5532"
FT   misc_feature    complement(25732..26061)
FT                   /note="Electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; Region: ETF_QO; pfam05187"
FT                   /db_xref="CDD:147396"
FT                   /locus_tag="BamMC406_5532"
FT   misc_feature    complement(25609..>25842)
FT                   /note="Ferredoxin-like protein [Energy production and
FT                   conversion]; Region: FixX; COG2440"
FT                   /db_xref="CDD:32561"
FT                   /locus_tag="BamMC406_5532"
FT   gene            complement(27305..29095)
FT                   /db_xref="GeneID:6181988"
FT                   /locus_tag="BamMC406_5533"
FT   CDS_pept        complement(27305..29095)
FT                   /locus_tag="BamMC406_5533"
FT                   /gene_family="HOG000258862" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_5773
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="GI:172064817"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:6181988"
FT                   /translation="MSYNAPVKDMLFVLKELAGIDTVAQLPGFEEAGYDTAQAVLEESA
FT                   KFCGEVLAPLNVEGDRNPSSWKDGVVTATPGFGAAFRQFVEGGWQGLQHPTEYDGQGLP
FT                   KLIATPCIEMLNASNLSFALCPLLTDGAIEALLTAGTDEQKQRYVPKLISGEWTGTMNL
FT                   TEPQAGSDLALVRSRAEPQGDGTYKVFGTKIFITWGEHDMADNIVHLVLARTPNAPEGV
FT                   KGISLFIVPKFMVNDDGSLGARNDVHCVSIEHKLGIKASPTAVLQYGDHGGAVGYLVGE
FT                   ENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAAFAKERVQSRPVDGSAKQSVTIIH
FT                   HPDVRRMLGTMRALTEGARALAYVAAAHSDIAHRHSDEATRTRHQAIYEYLVPVVKGWS
FT                   TEMVNDVASLGVQVHGGMGFIEETGAAQYYRDARILAIYEGTTAIQANDLVGRKTLRDG
FT                   GAVAKALIAEIGDTVAALGKLDGAAAASMKAQLEKGARALSSVVDYVLANAKQDPNAVF
FT                   AGSVPYLKLAGVVLCGWQMARALLAAHANRAHDTAFHDAKIAIAQCYAEHVLVQAGALE
FT                   ASIVGAKGNESVLALTEDQF"
FT                   /protein_id="YP_001815529.1"
FT   misc_feature    complement(27374..29095)
FT                   /note="acyl-CoA dehydrogenase; Provisional; Region:
FT                   PTZ00456"
FT                   /db_xref="CDD:185635"
FT                   /locus_tag="BamMC406_5533"
FT   misc_feature    complement(28997..29095)
FT                   /note="Acyl-CoA dehydrogenase N terminal; Region:
FT                   AcylCoA_DH_N; pfam12418"
FT                   /db_xref="CDD:152852"
FT                   /locus_tag="BamMC406_5533"
FT   misc_feature    complement(27734..28978)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BamMC406_5533"
FT   misc_feature    complement(order(27767..27769,27773..27775,27779..27787,
FT                   28505..28507,28511..28513,28607..28609,28613..28615,
FT                   28703..28705))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BamMC406_5533"
FT   gene            complement(29590..30507)
FT                   /db_xref="GeneID:6181989"
FT                   /locus_tag="BamMC406_5534"
FT   CDS_pept        complement(29590..30507)
FT                   /locus_tag="BamMC406_5534"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5774 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:172064818"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:6181989"
FT                   /translation="MAQLPDFEGLAMFAKVAEHGSFAAAARATGVSVATVSRGVARLES
FT                   RLGARLFNRTSRQLSLTEFGRTISEQAGEVYRRAEEAESSAREMSVQPRGLVRLAVPMS
FT                   FGLRWVAPLLPGFFRAYPEVSIDLHLSDASVDLIAEGFDAALRIAALPDSSLVARRLCA
FT                   VTQFVVASPEYLRREGRPTHPRELADRPCLSYAYRARSAVWRFTNDVGDEEPVMPTGPL
FT                   RVTNSDALLPTLLDGLAIAELPEFIAGEYLADGRLEAILTDWSLTKGGLYFVTPSARAR
FT                   PAKVTALSDYFAEHLSDPVWRWPK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001815530.1"
FT   misc_feature    complement(29626..30498)
FT                   /note="LysR family transcriptional regulator; Provisional;
FT                   Region: PRK14997"
FT                   /db_xref="CDD:184959"
FT                   /locus_tag="BamMC406_5534"
FT   misc_feature    complement(30310..30489)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="BamMC406_5534"
FT   misc_feature    complement(29635..30225)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BamMC406_5534"
FT   misc_feature    complement(order(29695..29697,29776..29778,29827..29829,
FT                   30016..30018,30022..30024,30064..30066,30181..30183,
FT                   30193..30195))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BamMC406_5534"
FT   misc_feature    complement(order(29800..29802,29809..29814,29833..29847,
FT                   29935..29937,30118..30138,30142..30144,30154..30156,
FT                   30163..30168,30172..30177,30187..30192))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BamMC406_5534"
FT   gene            30647..31411
FT                   /db_xref="GeneID:6181990"
FT                   /locus_tag="BamMC406_5535"
FT   CDS_pept        30647..31411
FT                   /locus_tag="BamMC406_5535"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_5775 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:172064819"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="GeneID:6181990"
FT                   /translation="MARKLDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRPAELD
FT                   AAVTGIVEAGGKATGVRSDSTRLDELDALYEQIKKEHGRLDVLFVNAGGGSMLPLGSIT
FT                   EAHYDETFDRNVKGVLFTVQKALPLLADGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FARSWILDLKERHVRVNTISPGATRTPGLLDLAGDDATQRQGLADYLAAQIPMGRLGEP
FT                   GEIASAALFLASDDASFVNGIELFVDGGQQQI"
FT                   /protein_id="YP_001815531.1"
FT   misc_feature    30647..31396
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="BamMC406_5535"
FT   sig_peptide     30647..30733
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.941 at
FT                   residue 29"
FT                   /locus_tag="BamMC406_5535"
FT   misc_feature    30656..31399
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="BamMC406_5535"
FT   gene            31486..32193
FT                   /db_xref="GeneID:6181991"
FT                   /locus_tag="BamMC406_5536"
FT   CDS_pept        31486..32193
FT                   /locus_tag="BamMC406_5536"
FT                   /gene_family="HOG000114205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pirin domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Pirin domain protein; KEGG: bam:Bamb_5776
FT                   pirin domain protein domain protein"
FT                   /db_xref="GI:172064820"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="GeneID:6181991"
FT                   /translation="MIERRAFLALAAIRHDGVDVRQHFRASESGHAGEAPLGPLLVWND
FT                   VEFAPHSGFGLRAHRDVEIVTWVRSGAITHEDDAGNRARLVANSVHVMSAGAAIHCAER
FT                   NDENVPARQFQIRLRPRTQASTSRCATRVCSLGCRESRFVTLASGDPEDVRAGALPIHA
FT                   DARMRIATLREGTAMHHALPLSGSAYLVVEHGRVDVGHITLARRDGITIRDETCVTLRA
FT                   KDDTDVVIVELLR"
FT                   /protein_id="YP_001815532.1"
FT   misc_feature    31528..32175
FT                   /note="Pirin-related protein [General function prediction
FT                   only]; Region: COG1741"
FT                   /db_xref="CDD:31927"
FT                   /locus_tag="BamMC406_5536"
FT   misc_feature    <31642..31833
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="BamMC406_5536"
FT   gene            complement(32271..32867)
FT                   /db_xref="GeneID:6181992"
FT                   /locus_tag="BamMC406_5537"
FT   CDS_pept        complement(32271..32867)
FT                   /locus_tag="BamMC406_5537"
FT                   /gene_family="HOG000229954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase domain protein; NADP
FT                   oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   mlo:mlr5281 hypothetical protein"
FT                   /db_xref="GI:172064821"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="GeneID:6181992"
FT                   /translation="MRYAIIGFGKIGHALARAFARNGIEVAVATTRDPESFAADAAAIG
FT                   PTIIPKTLAEAVRADIIFLAVRFESHPEVAKALRDWKGKTVVDAMNTQAPLEELGGLPS
FT                   SVFVANAFSGARLVKGFNHLVAAVLGQDPAIHGGRRVVFLASDDDGAAAEIGALAEKLG
FT                   FAPIKLGGLSDGGLLVHARGNQWGQLIFKDLITFD"
FT                   /protein_id="YP_001815533.1"
FT   misc_feature    complement(32274..32867)
FT                   /note="Predicted dinucleotide-binding enzymes [General
FT                   function prediction only]; Region: COG2085"
FT                   /db_xref="CDD:32268"
FT                   /locus_tag="BamMC406_5537"
FT   misc_feature    complement(32595..32864)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="BamMC406_5537"
FT   gene            complement(32895..33662)
FT                   /db_xref="GeneID:6181993"
FT                   /locus_tag="BamMC406_5538"
FT   CDS_pept        complement(32895..33662)
FT                   /locus_tag="BamMC406_5538"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bat:BAS1712 short chain
FT                   dehydrogenase"
FT                   /db_xref="GI:172064822"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:6181993"
FT                   /translation="MTQSLKGKTALVTGASRGIGRAIAERLAKDGATVALTYNASKSGA
FT                   DEAIAAIEKAGGTAFAIHADLVDAATVPALFEKLDDEFTQRNGSRALDILVNNAGNSGW
FT                   LGFKDATPESWDTLMAVYARAPFFIIQAALDRLADGARIINISSAAATKPVTAAPVYSM
FT                   AKAAINTLTHTLAIELGPRGITANAVAPGFTRTDANAAFRENPELVKAAEAQIALGRFG
FT                   EPSEIAAVVAFLASADGHWVTGQTIEASGGYKL"
FT                   /protein_id="YP_001815534.1"
FT   misc_feature    complement(32907..33656)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:180126"
FT                   /locus_tag="BamMC406_5538"
FT   misc_feature    complement(32907..33650)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="BamMC406_5538"
FT   gene            complement(33676..34410)
FT                   /db_xref="GeneID:6182338"
FT                   /locus_tag="BamMC406_5539"
FT   CDS_pept        complement(33676..34410)
FT                   /locus_tag="BamMC406_5539"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mlo:mlr5278 glucose dehydrogenase"
FT                   /db_xref="GI:172064823"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:6182338"
FT                   /translation="MNRLNGRTAVITGGATGIGRAAARRFIEEGAFVFIFGRRQEALDA
FT                   AVADLGPNARAVKGSVCELTDLDRLYAAVKAERGTLDIVFANAGAGSPLPLGQITAEHI
FT                   DDTFDTNVKGTIFTVQKALPLMGAGGSIILTGSSAGTTGAPGFTAYSASKAAVRNLART
FT                   WAEDLKGTGIRVNVLSPGATATELAKEALGEEGQKAYGAMTPLQRMADPAEIGAVAAFL
FT                   ASSDSSFMTASEVAVDGGLAQL"
FT                   /protein_id="YP_001815535.1"
FT   misc_feature    complement(33679..34314)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="BamMC406_5539"
FT   gene            34517..35458
FT                   /db_xref="GeneID:6182339"
FT                   /locus_tag="BamMC406_5540"
FT   CDS_pept        34517..35458
FT                   /locus_tag="BamMC406_5540"
FT                   /gene_family="HOG000233520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_A1130 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="GI:172064824"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:6182339"
FT                   /translation="MLDNVTINQLRAFVAVCDQGSFSGAARELRRAQSAISHAINALEN
FT                   AFDVMLFERNTRKATLTAAGRSLLPDARGVIARTEEMKMRAVAIAEAGVPQVSIAVDTY
FT                   FPRAHLIECLRTLQADYPTVAINLRMTTMQGGERLVLDGTCALAVTITDVPELSQDSIE
FT                   RHHLCDAQMVTVCAPSHPLAAIKGPIPREEFGRHIQLVVTDNQPDAEKTQQGVAGERQW
FT                   WVNDLGAKHDLLRGGLCWGHMPRHLVEQDLAKGLLVELQRRAWHMRALTFMISQRRGYS
FT                   FSECETQLVELLGHRHLVLKGGKAKVSVTRGR"
FT                   /protein_id="YP_001815536.1"
FT   misc_feature    34532..35356
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BamMC406_5540"
FT   misc_feature    34535..34714
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="BamMC406_5540"
FT   misc_feature    34802..35299
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="BamMC406_5540"
FT   misc_feature    order(34847..34852,34856..34861,34868..34870,34880..34882,
FT                   34886..34906,35177..35194,35210..35215,35219..35224)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BamMC406_5540"
FT   gene            35852..36442
FT                   /db_xref="GeneID:6182340"
FT                   /locus_tag="BamMC406_5541"
FT   CDS_pept        35852..36442
FT                   /locus_tag="BamMC406_5541"
FT                   /gene_family="HOG000014391" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5777 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="GI:172064825"
FT                   /db_xref="GeneID:6182340"
FT                   /translation="MNERPKPIADFVRIAGDLFRSDKLPPAARAFAPQVFARLQTPSDD
FT                   GKRLTLRYPACEWLDPALESVARVNPTFATVAQLIKSLEPNVGWSRRTSGKDGSPNYID
FT                   GHVNGMICGPGGAECRDDIQLGFSLMMPNVRYPDHGHAPEEAYVLMTAGEFRQQNGAWF
FT                   DPGIGGGIHNPPGALHAMRSGDAPFLAIWCLLN"
FT                   /protein_id="YP_001815537.1"
FT   gene            36988..38589
FT                   /db_xref="GeneID:6182341"
FT                   /locus_tag="BamMC406_5542"