(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCA_1

ID   BURCA_1; SV 1; empty ; DNA; empty ; PRO; 3294563 BP.
XX
AC   NC_008060;
XX
PR   Project: 58371;
XX
DE   Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence.
XX
OS   Burkholderia cenocepacia AU 1054
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3294563
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Complete sequence of chromosome 1 of Burkholderia cenocepacia AU 1054";
RL   Unpublished
XX
RN   [2]
RP   1-3294563
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (05-JUN-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3294563
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-MAY-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000378.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635680
CC   Source DNA and bacteria available from James M Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3294563
FT                   /strain="AU 1054"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia cenocepacia AU 1054"
FT                   /chromosome="1"
FT                   /db_xref="taxon:331271"
FT   gene            complement(278..1393)
FT                   /db_xref="GeneID:4090792"
FT                   /locus_tag="Bcen_0001"
FT   CDS_pept        complement(278..1393)
FT                   /locus_tag="Bcen_0001"
FT                   /gene_family="HOG000220942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxylate-amine ligase"
FT                   /transl_table="11"
FT                   /note="ATP-dependent; carboxylate-amine ligase with weak
FT                   glutamate--cysteine ligase activity"
FT                   /db_xref="GI:107021563"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="GeneID:4090792"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHSHEQAVSELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFVLTWDSFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLTDRPLKLSEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT                   /protein_id="YP_619890.1"
FT   misc_feature    complement(281..1393)
FT                   /note="Glutamate-cysteine ligase family 2(GCS2); Region:
FT                   GCS2; cl00954"
FT                   /db_xref="CDD:174478"
FT                   /locus_tag="Bcen_0001"
FT   misc_feature    complement(512..1357)
FT                   /note="uncharacterized enzyme; Region: gshA_cyan_rel;
FT                   TIGR02050"
FT                   /db_xref="CDD:162674"
FT                   /locus_tag="Bcen_0001"
FT   gene            complement(1408..2622)
FT                   /db_xref="GeneID:4090793"
FT                   /locus_tag="Bcen_0002"
FT   CDS_pept        complement(1408..2622)
FT                   /locus_tag="Bcen_0002"
FT                   /gene_family="HOG000253763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   bur:Bcep18194_A3249 sodium/hydrogen exchanger"
FT                   /db_xref="GI:107021564"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="GeneID:4090793"
FT                   /translation="MKSAFSFLPNWPLAPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDTSTDETSRLLMDVALGLLLFELGSRLDLRWIRRNPWLVASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPLYLLAGSFIVAYLVARSCNYLFRH
FT                   MTATMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWGDIALGGLLAIVLIVTRLVAKLAGVVAFAKPSGLGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCSIVILQLVSPFVVYRCLSAVGE
FT                   RSDSN"
FT                   /protein_id="YP_619891.1"
FT   misc_feature    complement(1552..2505)
FT                   /note="Sodium/hydrogen exchanger family; Region:
FT                   Na_H_Exchanger; pfam00999"
FT                   /db_xref="CDD:144551"
FT                   /locus_tag="Bcen_0002"
FT   gene            complement(2666..2992)
FT                   /db_xref="GeneID:4091873"
FT                   /locus_tag="Bcen_0003"
FT   CDS_pept        complement(2666..2992)
FT                   /locus_tag="Bcen_0003"
FT                   /gene_family="HOG000253752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107021565"
FT                   /db_xref="GeneID:4091873"
FT                   /translation="MKPKTCGAAQRRESIQSVPERKSCGTIGFLRVRSAKRRTCFNGTV
FT                   GTISNLNLRDCAVRSHTRPTIQIGNLNDVPPCGGTGGPHVPPSSSTTITFGAIPSRRAS
FT                   IPVA"
FT                   /protein_id="YP_619892.1"
FT   gene            complement(3294..5225)
FT                   /db_xref="GeneID:4091874"
FT                   /locus_tag="Bcen_0004"