(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCA_1.PE3

BURCA_1.PE3          Location/Qualifiers
FT   CDS_pept        complement(2666..2992)
FT                   /locus_tag="Bcen_0003"
FT                   /gene_family="HOG000253752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107021565"
FT                   /db_xref="GeneID:4091873"
FT                   /translation="MKPKTCGAAQRRESIQSVPERKSCGTIGFLRVRSAKRRTCFNGTV
FT                   GTISNLNLRDCAVRSHTRPTIQIGNLNDVPPCGGTGGPHVPPSSSTTITFGAIPSRRAS
FT                   IPVA"
FT                   /protein_id="YP_619892.1"
     ttgaaaccaa agacctgtgg cgccgcacag cgccgcgagt cgattcagtc ggttccggaa        60
     cgaaaaagct gtggcacaat cggtttcctt cgcgttcgtt cggccaagcg ccggacatgc       120
     ttcaacggaa cggtcggcac gatttcgaat ctgaatcttc gagactgcgc agtccgttca       180
     cacaccaggc cgacaatcca gatcggcaac ctgaacgacg ttccgccctg tggcggaaca       240
     ggcggacccc atgtaccgcc atcgtcgagc acaacaatca cattcggggc gatacccagc       300
     cggcgcgcat ccattcctgt cgcttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page