(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCA_2

ID   BURCA_2; SV 1; empty ; DNA; empty ; PRO; 2788459 BP.
XX
AC   NC_008061;
XX
PR   Project: 58371;
XX
DE   Burkholderia cenocepacia AU 1054 chromosome 2, complete sequence.
XX
OS   Burkholderia cenocepacia AU 1054
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2788459
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Complete sequence of chromosome 2 of Burkholderia cenocepacia AU 1054";
RL   Unpublished
XX
RN   [2]
RP   1-2788459
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (05-JUN-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2788459
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-MAY-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000379.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635680
CC   Source DNA and bacteria available from James M Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2788459
FT                   /strain="AU 1054"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia cenocepacia AU 1054"
FT                   /chromosome="2"
FT                   /db_xref="taxon:331271"
FT   gene            19..1329
FT                   /db_xref="GeneID:4095551"
FT                   /locus_tag="Bcen_2986"
FT   CDS_pept        19..1329
FT                   /locus_tag="Bcen_2986"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c, class I"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0808 cytochrome c, class I"
FT                   /db_xref="GI:107025344"
FT                   /db_xref="InterPro:IPR003219"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:4095551"
FT                   /translation="MKILRRIACFGLLVILVAAGWFAYTALRPSGPEPVSPFAGVPADL
FT                   PAGVARGAYLARAADCVACHTAPGGTPYAGGRAFDLPFGKIYSTNLTPDKETGIGDWTD
FT                   DAFVRAVRQGVGRAGHLYPAMPYTSYTAMSREDVLDIKTYLLSLAPVRQAAPLNTLAFP
FT                   FNQRWGMAFWNAIFFHEQRFRPDPAKSVEWNRGAYLAGPLGHCGECHTPRNAGFAMQSR
FT                   AYLSGADIDGWKAYNTTQDDLYGIGAWRDEQIAGYLSTGHARGRSSAAGPMAEVVEHSL
FT                   QHLTSNDIGALVAYLRGITPVKGGGAGPVELAPAAARASNPVLPGESARDENGRGRRLF
FT                   AADCAGCHQWNGAGRQSPYADLVGSRAVNDPSGTALMQVLLHGTNVQINGQTHMMPSFG
FT                   SVYSDADVAAVSNYVIAHFGDKKGTVTVQQVHGKRRD"
FT                   /protein_id="YP_622855.1"
FT   sig_peptide     19..96
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.871 at
FT                   residue 26"
FT                   /locus_tag="Bcen_2986"
FT                   /product="hypothetical protein"
FT   misc_feature    472..912
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="Bcen_2986"
FT   misc_feature    <874..>1143
FT                   /note="Cytochrome c [Energy production and conversion];
FT                   Region: COG3258"
FT                   /db_xref="CDD:33069"
FT                   /locus_tag="Bcen_2986"
FT   misc_feature    1021..1260
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="Bcen_2986"
FT   gene            complement(1641..2561)
FT                   /db_xref="GeneID:4095552"
FT                   /locus_tag="Bcen_2987"
FT   CDS_pept        complement(1641..2561)
FT                   /locus_tag="Bcen_2987"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   atc:AGR_pAT_467 probable transcription regulator PA2316"
FT                   /db_xref="GI:107025345"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095552"
FT                   /translation="MEQISLDRLTGLIAFSRAASLGSYSAAARALGVTPSAISKSIQRL
FT                   ERHFEIKLFNRTTRSLTLTQEGRDLHERTLRLLSEMEAIEQAAASARSEPAGILKVTAP
FT                   LPIGVHLIAPALPAFRQRFPKLSIDLRLGDHFVDLVGEGIDVAVRVGDLTGSRLVSRAL
FT                   SPHYIGAYASPDYLAKRGVPRHPDELVEHDCVNFRFQSSGQVLRWTFATDEGPLSLTPD
FT                   ADIVVDTSDAVAAVMAAGGGVGISPTYVAAAYVRRGELVPILTEFVEPRSTITALWPES
FT                   RRSSPNVKVLLAYLKKVFASYAAEH"
FT                   /protein_id="YP_622856.1"
FT   sig_peptide     complement(2469..2561)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.698) with cleavage site probability 0.432 at
FT                   residue 31"
FT                   /locus_tag="Bcen_2987"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(1653..2546)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen_2987"
FT   misc_feature    complement(2358..2537)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_2987"
FT   misc_feature    complement(1677..2273)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_2987"
FT   misc_feature    complement(order(1740..1742,1821..1823,1872..1874,
FT                   2064..2066,2070..2072,2112..2114,2229..2231,2241..2243))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_2987"
FT   misc_feature    complement(order(1845..1847,1854..1859,1878..1892,
FT                   1983..1985,2166..2186,2190..2192,2202..2204,2211..2216,
FT                   2220..2225,2235..2240))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_2987"
FT   gene            2671..3408
FT                   /db_xref="GeneID:4095553"
FT                   /locus_tag="Bcen_2988"
FT   CDS_pept        2671..3408
FT                   /locus_tag="Bcen_2988"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B2086 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:107025346"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4095553"
FT                   /translation="MTSDFDSHSLKSKSVLIFGGTSGIGLAAAKQAKAAGASVTVVGFN
FT                   PEGAEQVAIENGFAGWRSADVTRPETIVSALADIAHVDHLVLLAGTFVAGKVLDADVDY
FT                   LRRAFDERVWAAVHTLRALGDRLAADASVTFISGVLADRPNAYGTAILASASAAMEALA
FT                   RGLVLELAPRRVNTVSPGTTDTPLLARTLGEGRDAYVNALKDKLPLHRLGTAEEVGAAV
FT                   VFLMSNGSMNGETIHVDGGARLV"
FT                   /protein_id="YP_622857.1"
FT   sig_peptide     2671..2760
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.424 at
FT                   residue 30"
FT                   /locus_tag="Bcen_2988"
FT                   /product="hypothetical protein"
FT   misc_feature    2695..3393
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Bcen_2988"
FT   misc_feature    2716..3405
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_2988"
FT   gene            3465..4547
FT                   /db_xref="GeneID:4095531"
FT                   /locus_tag="Bcen_2989"
FT   CDS_pept        3465..4547
FT                   /locus_tag="Bcen_2989"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   zmo:ZMO1885 NADH:flavin oxidoreductase"
FT                   /db_xref="GI:107025347"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="GeneID:4095531"
FT                   /translation="MPTLFDPLRLGAIEVPNRILMAPMTRARGTREHVPTAMMADYYSQ
FT                   RASAGLIISEAIGISRQGLGWPYATGLWTAAQIAGWRTVTDAVHEAGGRIIAQLWHMGR
FT                   VVHPSFLDDAPPVSSSETTAPGHAHTYSGKQPYTQARALETKEIPAIIEQFAAAARNAL
FT                   QAGFDGVQLHASNGYLIDQFLRDSANFRGDAYGGSISNRLRLLIQATRAVADVAGPGRT
FT                   SVRLSPNGETQGVRDSDPLPLFIAAAEALSAVGIGFLELREPPLNGSFGVGYLDPLAAK
FT                   IRPAFKGPLVLNSDFDATRAQAELDAGVADAVTFGRPFISNPDFPRRLAEAIPLASDDP
FT                   ATWFTQDAQGYIDYPFAAST"
FT                   /protein_id="YP_622858.1"
FT   misc_feature    3465..4541
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="Bcen_2989"
FT   misc_feature    3471..4484
FT                   /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE
FT                   was the first flavin-dependent enzyme identified, however
FT                   its true physiological role remains elusive to this day.
FT                   Each monomer of OYE contains FMN as a non-covalently bound
FT                   cofactor, uses NADPH as a...; Region: OYE_like_FMN;
FT                   cd02933"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bcen_2989"
FT   misc_feature    order(3531..3533,3537..3539,3630..3632,3756..3758,
FT                   4137..4139,4344..4346,4404..4406,4410..4418)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bcen_2989"
FT   misc_feature    order(3531..3533,3537..3539,3630..3632,3756..3758,
FT                   3762..3764,3783..3785,3981..3983,3990..3992,3996..3998,
FT                   4137..4139,4158..4160,4344..4346,4404..4406,4410..4415)
FT                   /note="active site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bcen_2989"
FT   misc_feature    order(3537..3539,3762..3764,3981..3983,3990..3992,
FT                   3996..3998,4413..4415)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bcen_2989"
FT   misc_feature    3996..3998
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bcen_2989"
FT   gene            4709..5545
FT                   /db_xref="GeneID:4095532"
FT                   /locus_tag="Bcen_2990"
FT   CDS_pept        4709..5545
FT                   /locus_tag="Bcen_2990"
FT                   /gene_family="HOG000028061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_C6920 alpha/beta hydrolase"
FT                   /db_xref="GI:107025348"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4095532"
FT                   /translation="MSFITTRDGVDIFYKDWGPRDAQPIVFHHGWPLSADDWDTQMLFF
FT                   LANGYRVIAHDRRGHGRSSQVAEGHDMDHYAADAFALVETLDLRHAVHIGHSTGGGEVA
FT                   RYVARHGEPTGRVAKAILVSAVTPLMLKTPSNPEGLPLDVFDGLRKGLAENRAQFFVDV
FT                   PAGPFYGFNRPDATVHQGVIQNWWRQGMMGSAQAHYEGIKAFSETDQTEDLQLIGVPTL
FT                   VLHGEDDQIVPYKDAALKAIKLLKNGKLKTFPGFSHGMLTVNASVLNAELLAFVQE"
FT                   /protein_id="YP_622859.1"
FT   misc_feature    4709..5539
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Bcen_2990"
FT   misc_feature    4733..4960
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_2990"
FT   misc_feature    4856..5410
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_2990"
FT   gene            5622..6011
FT                   /db_xref="GeneID:4095533"
FT                   /locus_tag="Bcen_2991"
FT   CDS_pept        5622..6011
FT                   /locus_tag="Bcen_2991"
FT                   /gene_family="HOG000219335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="limonene-1,2-epoxide hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   nfa:nfa41920 hypothetical protein"
FT                   /db_xref="GI:107025349"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR013100"
FT                   /db_xref="GeneID:4095533"
FT                   /translation="MTTDVLAVALRFFSLWTENRIDDALSMLSDDVLYDNVPFPDIVGR
FT                   DNVRQFHGDFGIGTTFKVDWTVTHIAAAGNVVLNERIDVFQHESGGKITLPVMGTLTIV
FT                   DDRITVWRDYFDPADFDRQLSAIKK"
FT                   /protein_id="YP_622860.1"
FT   misc_feature    <5709..5993
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="Bcen_2991"
FT   gene            6210..7409
FT                   /db_xref="GeneID:4095534"
FT                   /locus_tag="Bcen_2992"
FT   CDS_pept        6210..7409
FT                   /locus_tag="Bcen_2992"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bur:Bcep18194_B0252 peptidase M20D,
FT                   amidohydrolase TIGRFAM: Peptidase M20D, amidohydrolase;
FT                   PFAM: peptidase M20; peptidase dimerisation"
FT                   /db_xref="GI:107025350"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:4095534"
FT                   /translation="MTTDTPNTRFTEVEDLMPAAGGLREIRHHIHHHPELAYEEHDTAA
FT                   LVADKLEQWGWQVTRGVGKTGVVGTLRVGDGTRSIGIRADMDALPIVEATGLPYASGTH
FT                   GKMHACGHDGHTTMLLGAAQHLAKTRNFSGTVHLYFQPAEEHGVDSGAKKMIDDGLFER
FT                   FPCDAVFGMHNHPGAAPGVFLTRRGPFMSAGDKAIITIEGVGGHAARPHLTVDPVVVAA
FT                   SIVMALQTIVARNVDPSQPAVVTVGSMHAGTANNVIPNGARLELSVRSFSPEVRALLKR
FT                   RITELAETQAASYGASANVEYIEGYPVVVNTDAETDFAAQVARELVGDAHVVEQTDLLM
FT                   GSEDFAFMLQQRPGSFVRLGNGEGEDGCMVHNPKYDFNDRNLPIGAAFWTRLVERYLGQ
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_622861.1"
FT   misc_feature    6318..7403
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Bcen_2992"
FT   misc_feature    <6318..7400
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Bcen_2992"
FT   gene            7466..8797
FT                   /db_xref="GeneID:4095535"
FT                   /locus_tag="Bcen_2993"
FT   CDS_pept        7466..8797
FT                   /locus_tag="Bcen_2993"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0253 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107025351"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4095535"
FT                   /translation="MQKDHLALHPASAEAADTGAPGAPAVTRRGAIAAAVIGNWLEFFD
FT                   FTVYGFFAVLIGKLFFPSSDPTTSLLLSVATFAAGFFTRPLGSVVLGVYADRKGRKAAL
FT                   NLTIMLMALGTGLIAIAPTYAQVGVAAPLLVVFARLLQGFSQGGEFGAATSTLLEQGGT
FT                   SRRGFRASWQLATQGGAALMGSGFAALLSNTMTKDALEGWGWRLPFLVGVLIAPVGMYL
FT                   RRRLADDAPGDRHHGIERGVLRELFSKHTRTVLLLMLTVMGGTVSTYILTFYMPTYAIH
FT                   TLGLPMKLSMFVGVASGCVMLVTCPLFGWLSDQLGSRRLPIFVGRGVLVALLFPAFWLM
FT                   NHHPTLSVILPLTALMLLFYSLGSASEMALMCESLPRHVRATGISIAYALAVTIFGGTA
FT                   QLIATWLVKTTGSKLAPAGYVAACVVLSLIAVAMLRETARESLD"
FT                   /protein_id="YP_622862.1"
FT   misc_feature    7559..8764
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_2993"
FT   misc_feature    7577..8749
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="Bcen_2993"
FT   misc_feature    order(7601..7603,7610..7618,7622..7627,7694..7696,
FT                   7703..7708,7715..7717,7727..7732,7736..7741,7901..7906,
FT                   7913..7918,7925..7930,7937..7939,7973..7978,7985..7990,
FT                   8006..8008,8258..8260,8267..8272,8279..8284,8291..8293,
FT                   8333..8335,8345..8347,8357..8359,8366..8368,8378..8380,
FT                   8534..8536,8543..8548,8555..8557,8567..8572,8579..8581,
FT                   8612..8617,8624..8629,8636..8638,8642..8644,8651..8653)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_2993"
FT   gene            complement(8816..9736)
FT                   /db_xref="GeneID:4095536"
FT                   /locus_tag="Bcen_2994"
FT   CDS_pept        complement(8816..9736)
FT                   /locus_tag="Bcen_2994"
FT                   /gene_family="HOG000233526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0254 transcriptional regulator, LysR family"
FT                   /db_xref="GI:107025352"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095536"
FT                   /translation="MAFTLSQLRIFQAVVEHGSLRAAARALDLAQSGVTQQLQGLEATL
FT                   GATLFTRTNRGIVPTAVGQRLLARSGSILGECEQVEREIRQLSGAYEGTVTLGLVTEPL
FT                   IDAFAPVLTAFRARFDKVDVHLRTGTSRMMIGWLRESAVDFAIALVAKQTDTTDLAVTP
FT                   LRTSAPVVVCRNGHPAMHAQSLAELGDYGWVSTRSPNLSADPVVNRLLAYFDTHGQPPP
FT                   KILATVEGMFETLQIVTQTDSLALETEAITRHGPFAGALVKVPVREQAEAQDICLLQRA
FT                   AVPLTPAAQELATMLASYLRVVRGR"
FT                   /protein_id="YP_622863.1"
FT   misc_feature    complement(8834..9736)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK09791"
FT                   /db_xref="CDD:170097"
FT                   /locus_tag="Bcen_2994"
FT   misc_feature    complement(9545..9724)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_2994"
FT   misc_feature    complement(8849..9457)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_2994"
FT   misc_feature    complement(order(9017..9022,9026..9031,9047..9064,
FT                   9353..9373,9377..9379,9389..9391,9398..9403,9407..9412))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_2994"
FT   gene            9873..10646
FT                   /db_xref="GeneID:4095537"
FT                   /locus_tag="Bcen_2995"
FT   CDS_pept        9873..10646
FT                   /locus_tag="Bcen_2995"
FT                   /gene_family="HOG000031896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bur:Bcep18194_B0255 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="GI:107025353"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4095537"
FT                   /translation="MKRFLVPLVFLCIGLAATSAYALDAHVVRLGIDPTYPPMDAKAPD
FT                   GSLKGFDVDLGNEICRRAQLRCQWVELEFSGMIPALQARKIDAILSSMAITAKREKQIL
FT                   FSSKLFRFKSRLVARPGSGLDGTAASLAGKRVGVQSGTQFESWALAHWAPAGVGVVPYK
FT                   SQDDVFADLVNGRLDAALLGTVEADYGFLRQPRGKGFAFVGAPLDMGDRGVGIGMRQSD
FT                   TALKASIDGAIASMLKDGTYDRIAKQYFDFNPYGD"
FT                   /protein_id="YP_622864.1"
FT   sig_peptide     9873..9941
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT                   /locus_tag="Bcen_2995"
FT                   /product="hypothetical protein"
FT   misc_feature    9885..10622
FT                   /note="lysine-arginine-ornithine-binding periplasmic
FT                   protein; Region: 3A0103s03R; TIGR01096"
FT                   /db_xref="CDD:162200"
FT                   /locus_tag="Bcen_2995"
FT   misc_feature    9954..10622
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_2995"
FT   misc_feature    order(9978..9980,10092..10094,10167..10169,10299..10301,
FT                   10419..10421)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_2995"
FT   misc_feature    order(10368..10370,10380..10382,10398..10400)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_2995"
FT   misc_feature    10500..10517
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_2995"
FT   gene            10702..11817
FT                   /db_xref="GeneID:4095538"
FT                   /locus_tag="Bcen_2996"
FT   CDS_pept        10702..11817
FT                   /locus_tag="Bcen_2996"
FT                   /gene_family="HOG000219334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bur:Bcep18194_B0256
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="GI:107025354"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="GeneID:4095538"
FT                   /translation="MQIRTTPLLSPSIGTQRTLTSFHFGPAGSGRKIYLQAALHADETP
FT                   AMLAAFVLKQRLAQLDAEGRLAAEIVLVPVSNPVGLNHHLLGQFIGRFDLASGRNFNRG
FT                   FLPLAEIAARARDRLGDDGARNRAIVRECVGAALDEIAPRTEFDALQLALLKLSHDADV
FT                   VIDLHCSLEAVMHVYTSDTAWPDVEPLARYLGAEVSLLAEDSGGHAFDDAHHLLWSQLR
FT                   AHLPDGTPMAAGTVAVTVECRGQRDVTYEYAQRDADALVDYLVWCGAVRGERAPLPPLA
FT                   APATPLAGSEQFYAPVSGILVHRAAIGATIRAGDPLFDIVDPLTDAITTISSATDGVFY
FT                   MRRAIRFVTAGAPLGRVTGMVPVRKGMLLGA"
FT                   /protein_id="YP_622865.1"
FT   misc_feature    10711..11772
FT                   /note="An uncharacterized subgroup of the Succinylglutamate
FT                   desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which
FT                   is part of the the M14 family of metallocarboxypeptidases.
FT                   This subgroup includes Pseudomonas aeruginosa AotO and
FT                   related proteins. ASTE...; Region: M14_PaAOTO_like;
FT                   cd06250"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="Bcen_2996"
FT   misc_feature    10786..11772
FT                   /note="Succinylglutamate desuccinylase / Aspartoacylase
FT                   family; Region: AstE_AspA; pfam04952"
FT                   /db_xref="CDD:147229"
FT                   /locus_tag="Bcen_2996"
FT   misc_feature    order(10819..10821,10828..10830,10975..10977,11005..11010,
FT                   11203..11205,11224..11226,11377..11379,11389..11391,
FT                   11422..11424)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="Bcen_2996"
FT   misc_feature    order(10819..10821,10828..10830,11203..11205)
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="Bcen_2996"
FT   gene            complement(12028..12855)
FT                   /db_xref="GeneID:4095539"
FT                   /locus_tag="Bcen_2997"
FT   CDS_pept        complement(12028..12855)
FT                   /locus_tag="Bcen_2997"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IclR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Beta-ketoadipate transcriptional regulator,
FT                   PcaR/PcaU/PobR; PFAM: regulatory proteins, IclR; KEGG:
FT                   bur:Bcep18194_B0262 transcriptional regulator, IclR family"
FT                   /db_xref="GI:107025355"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="GeneID:4095539"
FT                   /translation="MRYLLGCTTFQALMTTDDIQTKPGDSYVQSFARGLAVIRAFDAAR
FT                   PEQTLTEVASATGLTRAGARRILLTLQTLGYVEADGRLFRLTPKILELGFAYLTSMPFW
FT                   NLADPVMEQLSAQIHESCSAAVLDRTEIVYVLRVPTRKIMTINLSIGSRLPAYCTSMGR
FT                   VLLSALDDAALDETLAQSTIRAHTPRTITDLGELKAAIAQVRQQGWAVVDQELEVGLMS
FT                   LSAPIRNRRGQVIAAMNISGNAQRHTAKQMVKEFLGPLQQAAQTVSELVARRG"
FT                   /protein_id="YP_622866.1"
FT   misc_feature    complement(12043..12786)
FT                   /note="beta-ketoadipate pathway transcriptional regulators,
FT                   PcaR/PcaU/PobR family; Region: pcaR_pcaU; TIGR02431"
FT                   /db_xref="CDD:131484"
FT                   /locus_tag="Bcen_2997"
FT   misc_feature    complement(12511..12774)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_2997"
FT   misc_feature    complement(12052..12429)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Bcen_2997"
FT   gene            13044..14246
FT                   /db_xref="GeneID:4095540"
FT                   /locus_tag="Bcen_2998"
FT   CDS_pept        13044..14246
FT                   /locus_tag="Bcen_2998"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="catalyzes the thiolytic cleavage of
FT                   beta-ketoadipyl-CoA to succinate and acetyl-CoA"
FT                   /db_xref="GI:107025356"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="GeneID:4095540"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVD
FT                   WTAIDDVIYGCANQAGEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAI
FT                   KSGEAALMVAGGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSM
FT                   PETAENVAVDYNVSRADQDLFALRSQQKAARAQQDGTLAEEIVSVTIAQKKGDPVVVSR
FT                   DEHPRETSLEALAKLKGVVRPDGSVTAGNASGVNDGAAALLLANEATAKRFGLTPRARV
FT                   LGIATAGVAPRVMGIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT                   /transl_table="11"
FT                   /protein_id="YP_622867.1"
FT   misc_feature    13044..14243
FT                   /note="beta-ketoadipyl CoA thiolase; Validated; Region:
FT                   PRK09050"
FT                   /db_xref="CDD:169632"
FT                   /locus_tag="Bcen_2998"
FT   misc_feature    13056..14240
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bcen_2998"
FT   misc_feature    order(13110..13112,13194..13196,13239..13241,13248..13250,
FT                   13260..13262,13293..13304,13326..13328,13347..13352,
FT                   13359..13361,13404..13406,13893..13895,13899..13901,
FT                   13905..13907,13965..13967,14208..14213)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bcen_2998"
FT   misc_feature    order(13311..13313,14109..14111,14199..14201)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bcen_2998"
FT   gene            complement(14347..14943)
FT                   /db_xref="GeneID:4095541"
FT                   /locus_tag="Bcen_2999"
FT   CDS_pept        complement(14347..14943)
FT                   /locus_tag="Bcen_2999"
FT                   /gene_family="HOG000064200" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   bur:Bcep18194_B0264 protein of unknown function DUF523"
FT                   /db_xref="GI:107025357"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="GeneID:4095541"
FT                   /translation="MPRRIFRPAPAVISCHQPSRSATLNNAPPPPATPKILVSMCVVGH
FT                   PVRYNGSAKTAAHEALERWQREGRLVAVCPELAGGLNVPRPPAEIAGGASGQQVLSGHA
FT                   RIVDVNGADVTAPFVAGAQTALALAQAHDCRFAILADGSPSCGSTFIYDGSFASRRQAG
FT                   AGVTAALLREHGIEVFADTEIDALDARLRQLSQAG"
FT                   /protein_id="YP_622868.1"
FT   misc_feature    complement(14374..14841)
FT                   /note="Protein of unknown function (DUF523); Region:
FT                   DUF523; cl00733"
FT                   /db_xref="CDD:153961"
FT                   /locus_tag="Bcen_2999"
FT   gene            complement(14959..15519)
FT                   /db_xref="GeneID:4095542"
FT                   /locus_tag="Bcen_3000"
FT   CDS_pept        complement(14959..15519)
FT                   /locus_tag="Bcen_3000"
FT                   /gene_family="HOG000219313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0265 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:107025358"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4095542"
FT                   /translation="MTRRTAAERDALSARLLARDDVPLVWTIDRREIIEHLYVLRDGAL
FT                   HLVPEFYDVSGWPDGEADHYTPILLDCHDRGGWFLGRFDGARLVAAAIVDSRPLGPRRD
FT                   MLQLKFLHVSHDWRGCGLGEQLYRAAQVQARAMGAERLYVSATPSQRTIDFYLRLGFTV
FT                   STAPDPELYALEPDDIHLEGPTT"
FT                   /protein_id="YP_622869.1"
FT   misc_feature    complement(14965..15477)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen_3000"
FT   gene            complement(15516..16373)
FT                   /db_xref="GeneID:4095543"
FT                   /locus_tag="Bcen_3001"
FT   CDS_pept        complement(15516..16373)
FT                   /locus_tag="Bcen_3001"
FT                   /gene_family="HOG000219312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bur:Bcep18194_B0266 hypothetical protein"
FT                   /db_xref="GI:107025359"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:4095543"
FT                   /translation="MKKALHELNRLSWNTATVAHNSHKGDQAAFFRNGGSTLFPEEREL
FT                   LGDLTGLRLLHLQCNAGQDTLSLVRDGADATGVDISDEAIDFARQLSADAGLPARFERA
FT                   DVLDWMPAAAARGERFDRVFTSYGAICWLSDLSAWARGIASLLAPGGRFAMVEFHPFSL
FT                   YFDEQWQPRYDYFNGDAIEEPAGVGDYVAASGTGLGEQHDHPGIVDFANPHPSYEFMWG
FT                   IGDVVNALISARLVIDCLNEYPYSNGWKGFDGMRELEGRRMVPPEGMPRLPLMYAIAAH
FT                   RRAA"
FT                   /protein_id="YP_622870.1"
FT   misc_feature    complement(15906..16199)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen_3001"
FT   misc_feature    complement(order(15996..15998,16056..16064,16134..16139,
FT                   16185..16199))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen_3001"
FT   gene            16685..18229
FT                   /db_xref="GeneID:4095544"
FT                   /locus_tag="Bcen_3002"
FT   CDS_pept        16685..18229
FT                   /locus_tag="Bcen_3002"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS; PFAM: histidine kinase, HAMP region;
FT                   KEGG: bur:Bcep18194_B0267 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="GI:107025360"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="GeneID:4095544"
FT                   /translation="MRNNQPVTQQEFDFPDDVTLMSTTDADSVITYANTTFAQVSGFSN
FT                   EELVGQPHNVVRRPDMPKEAFADMWATLRRGEPWTALVKNRRKNGDHYWVRANAIPVMR
FT                   NGAPQGYMSVRTKAPHDETRAADALYRAFREGKAGRRRFHKGLVIRTGLLRIASLPQTM
FT                   SVRARVHSALYVLAPAVVGAGWACGLTGGGLAAFAGVTVGVAAAAGWWLDAQIVQPLKR
FT                   LHEQALNVATGESRRGVRMNRVDEIGMTLRTINQLGLMFRWLVDDVSEQVHNVQRASNE
FT                   IAQGNGDLSARTEQAASSVQQTAASMAEMTATVSSNAETALQANQLSVSASDAAERGGQ
FT                   AVSEVVTTMSEITASSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSANAAKEIKTLISASVERVESGARIVDGAGKTMEDIVTQVKRVSDLIAEIS
FT                   SSTAEQSTGVAQVDQAVVHLDNITQQNAALVEQSTAASESLKQQATRLVDAVNVFR"
FT                   /protein_id="YP_622871.1"
FT   misc_feature    16754..17026
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3002"
FT   misc_feature    16772..17029
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="Bcen_3002"
FT   misc_feature    order(16781..16783,16793..16795,16811..16813,16850..16861,
FT                   16937..16939,16952..16954)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3002"
FT   misc_feature    order(16841..16843,16853..16855,16877..16879,16886..16891,
FT                   16973..16975,16979..16981)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3002"
FT   misc_feature    17483..18226
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Bcen_3002"
FT   misc_feature    17654..18226
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Bcen_3002"
FT   gene            18578..20185
FT                   /db_xref="GeneID:4095545"
FT                   /locus_tag="Bcen_3003"
FT   CDS_pept        18578..20185
FT                   /locus_tag="Bcen_3003"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS; PFAM: histidine kinase, HAMP region;
FT                   KEGG: bur:Bcep18194_B0268 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="GI:107025361"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:4095545"
FT                   /translation="MRGVSNQSTSGRKIRHPELHTMRNNQPVTQREFEFADDATLMSTT
FT                   DADSYITYANAAFIQVSGFSPEEIEGQPHNVVRHPDMPKEAFADMWATLKGGEPWTALV
FT                   KNRRKNGDHYWVRANAIPVMRNGQPKGYMSVRTKATRDEIAAAEALYRDFREGKAGSRR
FT                   FHKGLIVRTGALRVASLFQTMSVRARLVSTLCVLAPAVVGAGWAAGLTGGGLAAFAGAA
FT                   VGVTAAAGLWLDAQIVRPLRQLRDEALRVATGESRSGVRMNRVDEIGMTLRTINQLGLM
FT                   FRWLVDDVSEQVLNVQRASNEIAQGNNDLSARTEQASTSVQQTAASMAEMTATVSSNAE
FT                   TALQANQLSVSASEAAGRGGQAVNEVVATMNDITDSSRKIADIIGVIDGIAFQTNILAL
FT                   NAAVEAARAGDQGRGFAVVAGEVRALAQRSANAAKEIKTLIGASVERVESGARIVDGAG
FT                   KTMEDIVTQVKRVSDLIAEISSSTAEQSTGVAQVDQAVVHLDNITQQNAALVEQSTAAS
FT                   ESLKQQAARLVEAVNVFR"
FT                   /protein_id="YP_622872.1"
FT   misc_feature    18692..18982
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    18728..18985
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    order(18737..18739,18749..18751,18767..18769,18806..18817,
FT                   18893..18895,18908..18910)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    order(18797..18799,18809..18811,18833..18835,18842..18847,
FT                   18929..18931,18935..18937)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    19286..19411
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    order(19286..19291,19298..19303,19307..19312,19319..19324,
FT                   19328..19330,19376..19381,19385..19390,19397..19402,
FT                   19406..19411)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    19439..20182
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Bcen_3003"
FT   misc_feature    19607..20182
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Bcen_3003"
FT   gene            complement(20300..21769)
FT                   /db_xref="GeneID:4095546"
FT                   /locus_tag="Bcen_3004"
FT   CDS_pept        complement(20300..21769)
FT                   /locus_tag="Bcen_3004"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="KEGG: bur:Bcep18194_B0279 succinic semialdehyde
FT                   dehydrogenase TIGRFAM: succinic semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="GI:107025362"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="GeneID:4095546"
FT                   /translation="MSTVQETLALKDPSLFRQQAYVNGEWQGATNGETFEVRNPATGGL
FT                   LGTVPAMGTAETRHAIDAANAAWPAWRKKTAKERAVILRKWHDLMMDNADDLALILTTE
FT                   QGKSLAEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPASDKRIVVTKEAIGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGDPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   QGAIASKYRNSGQTCVCTNRFYVHEAVYDQFAQKLAAAVGQLKVGRGTEPGVTQGPLIN
FT                   EAAVLKVEAHIEDALAKGATVVTGGKRHALGHGFFEPTVLTGVTPAMKVAKEETFGPLA
FT                   PLFKFGSDDEVIRLANDTEFGLAAYFYSRDIGRVWKVAEALEYGMVGVNTGLISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYLCLAV"
FT                   /transl_table="11"
FT                   /protein_id="YP_622873.1"
FT   misc_feature    complement(20330..21709)
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="Bcen_3004"
FT   misc_feature    complement(20309..21661)
FT                   /note="Mitochondrial succinate-semialdehyde dehydrogenase
FT                   and ALDH family members 5A1 and 5F1-like; Region:
FT                   ALDH_F5_SSADH_GabD; cd07103"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcen_3004"
FT   misc_feature    complement(order(20309..20329,20363..20365,20378..20380,
FT                   20396..20401,20408..20410,20426..20446,20450..20452,
FT                   20459..20461,20465..20467,20477..20482,20486..20488,
FT                   20690..20692,20828..20830,20840..20842,21011..21013,
FT                   21020..21022,21032..21034,21068..21070,21314..21316,
FT                   21329..21337,21353..21379,21383..21388,21395..21397,
FT                   21518..21520,21545..21547))
FT                   /note="tetramerization interface; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcen_3004"
FT   misc_feature    complement(order(20393..20395,20507..20509,20585..20587,
FT                   20591..20593,20882..20884,20978..20986,21026..21031,
FT                   21038..21040,21047..21058,21200..21205,21209..21211,
FT                   21254..21256,21278..21292))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcen_3004"
FT   misc_feature    complement(order(20882..20884,20891..20893,20984..20986,
FT                   21278..21280))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcen_3004"
FT   gene            complement(21861..23150)
FT                   /db_xref="GeneID:4095547"
FT                   /locus_tag="Bcen_3005"
FT   CDS_pept        complement(21861..23150)
FT                   /locus_tag="Bcen_3005"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B0280
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="GI:107025363"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:4095547"
FT                   /translation="MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFI
FT                   DFAAGIAVLNTGHRHPKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPK
FT                   KTAFFTTGAEAVENAIKIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPF
FT                   PGDVFHAPYPNAVHGVTTADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEF
FT                   VRALRKICNEHGILLIADEVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVV
FT                   GRADVMDAAAPGGLGGTYAGNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQ
FT                   ADVPQIADVRGPGAMIAVEFLKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRF
FT                   LFPLTIPQAVFDEALVILEEVLKETVGVPA"
FT                   /protein_id="YP_622874.1"
FT   misc_feature    complement(21885..23144)
FT                   /note="4-aminobutyrate aminotransferase; Provisional;
FT                   Region: PRK06777"
FT                   /db_xref="CDD:168673"
FT                   /locus_tag="Bcen_3005"
FT   misc_feature    complement(21888..23129)
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcen_3005"
FT   misc_feature    complement(order(22344..22346,22422..22427,22431..22433,
FT                   22530..22532,22725..22727,22731..22736,22812..22820))
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcen_3005"
FT   misc_feature    complement(order(22344..22346,22422..22424,22431..22433,
FT                   22530..22532,22731..22736,22812..22817))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcen_3005"
FT   misc_feature    complement(22344..22346)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcen_3005"
FT   gene            23271..24779
FT                   /db_xref="GeneID:4095548"
FT                   /locus_tag="Bcen_3006"
FT   CDS_pept        23271..24779
FT                   /locus_tag="Bcen_3006"
FT                   /gene_family="HOG000223052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0281 transcriptional regulator, GntR family
FT                   with aminotransferase activity"
FT                   /db_xref="GI:107025364"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:4095548"
FT                   /translation="MRASVLSDWLAQRLVRGGEQPIYRQLHRLLQQAILSRELPAGTRV
FT                   PSSRLLAAELGIARNTVTQVYEQLALEGYVNSATGRGTFVADSAPDEIVGAPPDAGAGP
FT                   AVVTPSVRRLSARGTRLVEGAGVSKRQGGAFMPGVPDVSRFPARVWTRLHNKYWRRLRP
FT                   DLLTYAPGGGLALLREALADYLRTSRSVRCTPEQIVITTGIHQSIDLAVRLLTDPGDAI
FT                   WTEDPCYWGVRSVLNVSGLTTRPIPVDDEGIAPSAADLAEPPKLMLVTPSHQYPLGMVM
FT                   SLARRRMLLEYARQHGCWIIEDDYDSEFRYGSRPLASLQGLDTAGQVIYVGSFGKTLFP
FT                   GLRVGYLVAPEPLAESFATASAELYREGQLLQQAVLAEFIAEGHFVSHIRKMRTLYGQR
FT                   REVLLEAVARRYGDTLHALGSDAGLHLVTQLPAGVDDRAVAQAALARNIVVRPLSGYYA
FT                   DRSRAASGLLLGYACVPEDEIATAFATLAEAIDERAFGGAVAVA"
FT                   /protein_id="YP_622875.1"
FT   misc_feature    23322..24752
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    23331..23528
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    order(23331..23333,23337..23339,23406..23408,23412..23417,
FT                   23439..23453,23457..23462,23469..23471,23499..23504,
FT                   23508..23519)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    23682..24734
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    order(23877..23885,23955..23957,24093..24095,24186..24188,
FT                   24267..24269,24273..24278,24297..24299)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    order(23886..23888,23985..23987,24165..24167,24291..24299,
FT                   24384..24386,24393..24395)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcen_3006"
FT   misc_feature    24276..24278
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcen_3006"
FT   gene            complement(25049..25885)
FT                   /db_xref="GeneID:4095549"
FT                   /locus_tag="Bcen_3007"
FT   CDS_pept        complement(25049..25885)
FT                   /locus_tag="Bcen_3007"
FT                   /gene_family="HOG000185787" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0286 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="GI:107025365"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:4095549"
FT                   /translation="MDHLFIGLVLCSALLHAIWNAFLHVSEDRLVQLGTMSLPYLAFGI
FT                   AGAVLLPAPAPAAWPYVAASAALEVAYCFTLARAYRNGEFGQIYPIARGISPLLVSVLA
FT                   LAMLHERPTPFGFAGIALVSFGIMSLALRRGFRFSGEGVPYALLTGVFIAAYSICDGIG
FT                   SRVSGSALGYIAWVYLLWSVPQLVLVCAVRGGPRAVLGSRSAFTQGAIAGTISLAAYGI
FT                   VILAYRHLPVATVSALRETSSIFAVAIGWFVMRERPGPQRLAACALVVAGAALIRL"
FT                   /protein_id="YP_622876.1"
FT   misc_feature    complement(25100..25876)
FT                   /note="phosphonate utilization associated putative membrane
FT                   protein; Region: phn_DUF6; TIGR03340"
FT                   /db_xref="CDD:163219"
FT                   /locus_tag="Bcen_3007"
FT   gene            25989..27062
FT                   /db_xref="GeneID:4095550"
FT                   /locus_tag="Bcen_3008"
FT   CDS_pept        25989..27062
FT                   /locus_tag="Bcen_3008"
FT                   /gene_family="HOG000219300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="selenophosphate synthetase"
FT                   /EC_number="2.7.9.3"
FT                   /note="catalyzes the formation of selenophosphate from
FT                   selenide and ATP"
FT                   /db_xref="GI:107025366"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="GeneID:4095550"
FT                   /translation="MPTMTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPP
FT                   ALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAM
FT                   GGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGLAAI
FT                   GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPG
FT                   AELAALPGVHALTDVTGFGLLGHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTG
FT                   ASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVACAPEAVDDVLACFRADGFDR
FT                   AAVIGEMVDGPARVDVA"
FT                   /transl_table="11"
FT                   /protein_id="YP_622877.1"
FT   misc_feature    26022..27056
FT                   /note="selenophosphate synthetase; Provisional; Region:
FT                   PRK00943"
FT                   /db_xref="CDD:167111"
FT                   /locus_tag="Bcen_3008"
FT   misc_feature    26037..27029
FT                   /note="Selenophosphate synthetase  (SelD) catalyzes the
FT                   conversion of selenium to selenophosphate which is required
FT                   by a number of bacterial, archaeal and eukaryotic organisms
FT                   for synthesis of Secys-tRNA, the precursor of
FT                   selenocysteine in selenoenzymes. The...; Region: SelD;
FT                   cd02195"
FT                   /db_xref="CDD:100031"
FT                   /locus_tag="Bcen_3008"
FT   misc_feature    order(26199..26210,26214..26216,26220..26222,26286..26288,
FT                   26316..26318,26325..26327,26334..26336,26433..26435,
FT                   26454..26459,26469..26471,26730..26732)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100031"
FT                   /locus_tag="Bcen_3008"
FT   misc_feature    order(26274..26276,26286..26288,26427..26435)
FT                   /note="putative ATP binding site; other site"
FT                   /db_xref="CDD:100031"
FT                   /locus_tag="Bcen_3008"
FT   gene            27135..27728
FT                   /db_xref="GeneID:4095261"
FT                   /locus_tag="Bcen_3009"
FT   CDS_pept        27135..27728
FT                   /locus_tag="Bcen_3009"
FT                   /gene_family="HOG000122946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine exporter protein LysE/YggA"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0288 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="GI:107025367"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:4095261"
FT                   /translation="MNDFLFGLMIALSVGPVALMIANYGMRAGTATGVRAAIGVAAADG
FT                   CHAVVAFTIGAMLAGTLASHLSLFRMVGALVLLAMGARMLWQALRDRRRTLDGDVVPPP
FT                   GNRPFMAMFFVTLANPLTILLFYGYATAAAGAHRHWLLGAACVFAGSLIGQLVFAFGGG
FT                   AIGRFVKSPGWLAASHVVAALVVLGYGVAGLMRV"
FT                   /protein_id="YP_622878.1"
FT   misc_feature    27156..27650
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Bcen_3009"
FT   gene            27957..29036
FT                   /db_xref="GeneID:4095262"
FT                   /locus_tag="Bcen_3010"
FT   CDS_pept        27957..29036
FT                   /locus_tag="Bcen_3010"
FT                   /gene_family="HOG000219288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine nucleoside permease"
FT                   /transl_table="11"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   bur:Bcep18194_B0289 purine nucleoside transporter"
FT                   /db_xref="GI:107025368"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="GeneID:4095262"
FT                   /translation="MLTRSILSAAAFSLAACATAPSIAQDNQGNDAGNAAFAETGSHGR
FT                   PVKVMIITMFGPEGQAWLDRLGPWRDVTVPGLSPDYPAVHCNKQDVCVVTTGMGYANAS
FT                   ATIMALTFSQRFDLRRTYFLVSGIAGVDPAQGTVGSAAWSKYLVDFSLQWELDAREIPA
FT                   GWNTGYLGINTKSPNDKPPLDYRTEVFQLNPQLTDAAYALSRNVVLADSAQAQAARAKF
FT                   TYAPANRPPTVIQCDTSSGNTWFSGTLIGERARQWTKILTDGKGTYCMTAQEDNATYEA
FT                   LKRAASVKRVDLSRVAVLRTGSDFDRPYAGQTSADNLLNYADQGGFAPATENLYRAGNP
FT                   LVQDIVTHWGEWRDGVPRR"
FT                   /protein_id="YP_622879.1"
FT   sig_peptide     27957..28031
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="Bcen_3010"
FT                   /product="hypothetical protein"
FT   misc_feature    28089..29030
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Bcen_3010"
FT   gene            complement(29264..29557)
FT                   /db_xref="GeneID:4095263"
FT                   /locus_tag="Bcen_3011"
FT   CDS_pept        complement(29264..29557)
FT                   /locus_tag="Bcen_3011"
FT                   /gene_family="HOG000219267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0292 hypothetical protein"
FT                   /db_xref="GI:107025369"
FT                   /db_xref="GeneID:4095263"
FT                   /translation="MNRRHLLSALALTLAVSAPAFADSGTPHAGDYANTSWYSQHNGPR
FT                   TRAEVRAEVEQARKDGTLAYLRKATSYPQGLELAQGPYRPLPEGNQLAGGGR"
FT                   /protein_id="YP_622880.1"
FT   sig_peptide     complement(29489..29557)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT                   /locus_tag="Bcen_3011"
FT                   /product="hypothetical protein"
FT   gene            complement(29966..30970)
FT                   /db_xref="GeneID:4095264"
FT                   /locus_tag="Bcen_3012"
FT   CDS_pept        complement(29966..30970)
FT                   /locus_tag="Bcen_3012"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0293 transcriptional regulator, LysR family"
FT                   /db_xref="GI:107025370"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095264"
FT                   /translation="MDRLQAMQVFTRVVDTSSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQANNRKPHGKLRIDMPGSIGR
FT                   LLVIPSLCEFHTRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEC
FT                   VTVASPDYLERHGEPQTIDDLGQHKAVNYFSSRTGRTIDWTFLIDGKEVEMKMEGIVSV
FT                   NDADAYVTCGIEGFGLIQPPLFMVLPHLREGRLKEVLPGVKPLPMPVSVVYPHSRHLSP
FT                   KVRVFVDWIAEVFDRCPLLSGKGSLDATCSKRTFEEAERAPVLDTPVINEWVA"
FT                   /protein_id="YP_622881.1"
FT   misc_feature    complement(30083..30970)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen_3012"
FT   misc_feature    complement(30785..30961)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3012"
FT   misc_feature    complement(30092..30697)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_CrgA_like_3; cd08472"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="Bcen_3012"
FT   misc_feature    complement(order(30164..30166,30245..30247,30296..30298,
FT                   30488..30490,30494..30496,30536..30538,30653..30655,
FT                   30665..30667))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="Bcen_3012"
FT   misc_feature    complement(order(30269..30271,30278..30283,30302..30316,
FT                   30407..30409,30590..30610,30614..30616,30626..30628,
FT                   30635..30640,30644..30649,30659..30664))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="Bcen_3012"
FT   gene            31064..32005
FT                   /db_xref="GeneID:4095265"
FT                   /locus_tag="Bcen_3013"
FT   CDS_pept        31064..32005
FT                   /locus_tag="Bcen_3013"
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /transl_table="11"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   bur:Bcep18194_B0294 esterase/lipase/thioesterase"
FT                   /db_xref="GI:107025371"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="GeneID:4095265"
FT                   /translation="MLPDYRHLSQCLPDPEFVPSRNGCCIVMDASEFSKFLKAALPAQA
FT                   LTGAALTVAEVEIPGYAQDIVLRLYRRPDKTGLPVVLYFHGGGFVRGSLEDADFAARFL
FT                   AERLPALVVSVDYSLAPAFPFPAAPEDAYRAAVWAATRARAFGGNPKKIGVAGHDAGGQ
FT                   LANCLAFIARDRGEVSIAAQALFGPMLDPSMTRIGDAERLASDITARECAACYRAYLPQ
FT                   AAQRMHPYAAPIESVRLAGLPPTLVVTAQNDVLHVEAEKYAGCLISSGVLTQVIRYPDI
FT                   THAALATHEAAFEEAVRFFQCRFQARQPNRPE"
FT                   /protein_id="YP_622882.1"
FT   misc_feature    31295..>31714
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_3013"
FT   misc_feature    31304..31915
FT                   /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
FT                   pfam07859"
FT                   /db_xref="CDD:149109"
FT                   /locus_tag="Bcen_3013"
FT   misc_feature    order(31319..31327,31535..31543,31550..31552)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29383"
FT                   /locus_tag="Bcen_3013"
FT   gene            32044..33261
FT                   /db_xref="GeneID:4095266"
FT                   /locus_tag="Bcen_3014"
FT   CDS_pept        32044..33261
FT                   /locus_tag="Bcen_3014"
FT                   /gene_family="HOG000158246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD"
FT                   /transl_table="11"
FT                   /note="PFAM: secretion protein HlyD; KEGG:
FT                   bur:Bcep18194_B0295 secretion protein, HlyD family"
FT                   /db_xref="GI:107025372"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:4095266"
FT                   /translation="MAILRTSRSRIATAAIVTLAVVGLGTFGAMRVNANAPEKAAAPLP
FT                   EVDVATVVPQTVTDWQSYSGRLEAVEKVDVRPQVSGTIVAVNFKDGALVKKGDVLFVID
FT                   PRPYQAEVDRAAAQLAAAQARNGYAQTDWQRAQRLIGDNAIAKRDYDEKQNAAREANAN
FT                   LKAAEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAAPLTTLVSVSPIYA
FT                   SFDADEQTYLQYINGARSGRKVPVELGLANETGYSRSGEIDSVDNRLDTSSGTIRVRAR
FT                   FDNADGTLVPGLYARVKVGGSAPHEALLVDDAAINTDQDKKFVFVVDQQGRVSYREVQP
FT                   GMQHGNRRVIVSGLAAGDRVVVNGTQRVRPGAQVKPHMVPMTGGDEPSAPLASTAKPAA
FT                   PAKADS"
FT                   /protein_id="YP_622883.1"
FT   sig_peptide     32044..32148
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.986 at
FT                   residue 35"
FT                   /locus_tag="Bcen_3014"
FT                   /product="hypothetical protein"
FT   misc_feature    32182..33171
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="Bcen_3014"
FT   gene            33307..36492
FT                   /db_xref="GeneID:4095267"
FT                   /locus_tag="Bcen_3015"
FT   CDS_pept        33307..36492
FT                   /locus_tag="Bcen_3015"
FT                   /gene_family="HOG000158129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrophobe/amphiphile efflux-1 HAE1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Hydrophobe/amphiphile efflux-1 HAE1; PFAM:
FT                   acriflavin resistance protein; KEGG: bur:Bcep18194_B0296
FT                   hydrophobe/amphiphile efflux pump, HAE1"
FT                   /db_xref="GI:107025373"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="GeneID:4095267"
FT                   /translation="MNISKFFIDRPIFAGVLSVIILLGGVIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPDNRYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGSGDYAMRVWLDPQKVAQRGLSAEDVVQSIREQNVQVAAGVI
FT                   GASPSLPGTPLQLSVNARGRLQTEDEFGDIVVKTTPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLQISDEVRKTMAELKQDMPAGVDYKIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASLIPLIAVPVSIIGTFSLLLAFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIEGGMNARQATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRGFNKVFHRGAENYGRGVRGVLSRKTLMLGVYLVLVGATVLVSKVVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGSIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFSERHGKALSAGAIAGALNQKYSAMKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYAKLSDATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVPVTDV
FT                   FNTMQVYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNDKGEMVPLSSLV
FT                   TVTPTFGPEMVVRYNGYTAADINGGPAPGFSSGQAQAAVERIAHETLPRGVRFEWTDLT
FT                   YQQILAGDSAMYVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTQGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGRTPLEAAIEASRLRLRPILMTSIAF
FT                   IMGVVPLVTSTGAGSEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAG
FT                   KDSTGYGVPAPDA"
FT                   /protein_id="YP_622884.1"
FT   misc_feature    33313..36417
FT                   /note="AcrB/AcrD/AcrF family; Region: ACR_tran; pfam00873"
FT                   /db_xref="CDD:144459"
FT                   /locus_tag="Bcen_3015"
FT   gene            36503..38044
FT                   /db_xref="GeneID:4095268"
FT                   /locus_tag="Bcen_3016"
FT   CDS_pept        36503..38044
FT                   /locus_tag="Bcen_3016"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT; PFAM: outer membrane efflux protein;
FT                   KEGG: bur:Bcep18194_B0297 RND efflux system, outer membrane
FT                   lipoprotein, NodT family"
FT                   /db_xref="GI:107025374"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:4095268"
FT                   /translation="MNNLHNTNGLMRFAKVAAASTLLATLLAACAVGPDYKRPDAAAPA
FT                   AFKEAPTLAAGEQAGTWKTAEPADGEHRGEWWKVFGDPVLDSLETQALAANQNLKAAAA
FT                   RVEEARAATRSARSQWFPQVGAGFGPTREGLSSASQFQPQGTGPTNATLWRAQGTVSYE
FT                   ADLFGRVGRNVEASRADQAQSEALFRSVQLALQADVAQNYFELRQLDSDQDLYRRTVEL
FT                   REQALKLVQRRFNEGDISELDVSRAKNELASAQADAVGVARRRAASEHALAILLGKAPA
FT                   DFAFKETPIVPVAVKIPPGLPSALLERRPDVSAAERAMAAANARIGLAKSAYFPKLDIT
FT                   GSFGYEASTLGNLFLWSSRTFLLGPFAGTALTLPLFDGGRRAAGVQQARAQYDEQVANY
FT                   RQQVLVAFREVEDNLADLRLLDDQIRAQDAAVNASRRAATLSRTQYQEGEVAYLDVIDS
FT                   ERSVLQSQLQANQLTGAQAVSTVNLIRALGGGWGNAPAPTAVGDAASGKADVAAR"
FT                   /protein_id="YP_622885.1"
FT   sig_peptide     36503..36598
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.986 at
FT                   residue 32"
FT                   /locus_tag="Bcen_3016"
FT                   /product="hypothetical protein"
FT   misc_feature    36596..37972
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="Bcen_3016"
FT   misc_feature    36857..37333
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcen_3016"
FT   misc_feature    37403..37966
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcen_3016"
FT   gene            38431..38844
FT                   /db_xref="GeneID:4095269"
FT                   /locus_tag="Bcen_3017"
FT   CDS_pept        38431..38844
FT                   /locus_tag="Bcen_3017"
FT                   /gene_family="HOG000219253" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107025375"
FT                   /db_xref="GeneID:4095269"
FT                   /translation="MSTEWKHRVRLFVQRFWQPTTACMTCMPGSWGNITSLPHWTIAFH
FT                   TGLLTGLLAVLLTFTPVGKLYAHRYGNALVVGVLTTLGDAYSHTSHYRIPYVEHIVTGV
FT                   ISGLLALAASYLLEDRARRLRAAWARVFGQLIR"
FT                   /protein_id="YP_622886.1"
FT   gene            complement(39037..39927)
FT                   /db_xref="GeneID:4095270"
FT                   /locus_tag="Bcen_3018"
FT   CDS_pept        complement(39037..39927)
FT                   /locus_tag="Bcen_3018"
FT                   /gene_family="HOG000233520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0300 transcriptional regulator, LysR family"
FT                   /db_xref="GI:107025376"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095270"
FT                   /translation="MLTSDHIDMLLTVIDKGSFSAAARALGRTPSAVSMAIANLEAELD
FT                   LVLFDRGTREPTPTAAMAALLPDARAIAERLHALRAHAQHLSEGVEDTLRLGLAAEIDG
FT                   VPIARALTAVATKYPALAVSVVTAPQDAIVDALHRGTVDLCVAYGGLDLHPQEQIHALW
FT                   TETLIAVAAPGHPAIAEAAHPEAIERLSGFRQIVIADPERPLTDVRPLIGNRTWKVTDM
FT                   GTAIALVKAGHGWANLPESVIGRYVADGELAPLVFANIRNGLPLPVYLRRPKHTGLGKA
FT                   ASELVRALRAERADT"
FT                   /protein_id="YP_622887.1"
FT   misc_feature    complement(39040..39924)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_3018"
FT   misc_feature    complement(39751..39915)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3018"
FT   misc_feature    complement(39061..39651)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_3018"
FT   misc_feature    complement(order(39235..39240,39244..39249,39265..39273,
FT                   39547..39567,39571..39573,39583..39585,39592..39597,
FT                   39601..39606))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_3018"
FT   gene            40029..40469
FT                   /db_xref="GeneID:4095271"
FT                   /locus_tag="Bcen_3019"
FT   CDS_pept        40029..40469
FT                   /locus_tag="Bcen_3019"
FT                   /gene_family="HOG000218246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transmembrane pair"
FT                   /transl_table="11"
FT                   /note="PFAM: transmembrane pair; KEGG: bur:Bcep18194_B0301
FT                   transmembrane protein"
FT                   /db_xref="GI:107025377"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="GeneID:4095271"
FT                   /translation="MQGWKRRIVYVVMFEVLGILVASSVLGMLSGASAATSGLLGVMIS
FT                   TTGVTVNFLYNLGFEAWERRRAETTRTVGRRVVHAIGFQVALVTFLIPLIAWWLDVSLW
FT                   QAFLYDAVLIVFFPIFTFTYNWAFDSVFGLPDAVTRKAAPVA"
FT                   /protein_id="YP_622888.1"
FT   sig_peptide     40029..40133
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.924 at
FT                   residue 35"
FT                   /locus_tag="Bcen_3019"
FT                   /product="hypothetical protein"
FT   misc_feature    40032..40205
FT                   /note="Bacterial Transmembrane Pair family; Region: BTP;
FT                   pfam05232"
FT                   /db_xref="CDD:147435"
FT                   /locus_tag="Bcen_3019"
FT   misc_feature    40269..40427
FT                   /note="Bacterial Transmembrane Pair family; Region: BTP;
FT                   pfam05232"
FT                   /db_xref="CDD:147435"
FT                   /locus_tag="Bcen_3019"
FT   gene            complement(40572..41423)
FT                   /db_xref="GeneID:4095272"
FT                   /locus_tag="Bcen_3020"
FT   CDS_pept        complement(40572..41423)
FT                   /locus_tag="Bcen_3020"
FT                   /gene_family="HOG000028072" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B0304 alpha/beta hydrolase"
FT                   /db_xref="GI:107025378"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR008262"
FT                   /db_xref="GeneID:4095272"
FT                   /translation="MNMRIEPSVLANPDLQFATLSSGISLPYVERGSGAPMVFVHGSLC
FT                   DYRYWDPQLAALSAHYRCIAPSLSHYWPAVEAGIQDEFSWQNHVDELAEFIDALDLGPV
FT                   HLVGHSRGGSVAFNVARQHPHLVESLTLADPGGPLQQPGVREAALPAAALALRTKAVNL
FT                   IDQGDVEAGLEMFVDSVSLPGAWKKSTARFRTMAIDNASTLPKQLRDPLPAYSQHTAGD
FT                   IACRTLLIDGQRSPKMFRHNVDTLSQWIGHAQRQTVAGASHGMNAASPAVFNRYVHEFV
FT                   AA"
FT                   /protein_id="YP_622889.1"
FT   misc_feature    complement(40575..41363)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Bcen_3020"
FT   misc_feature    complement(<41055..41339)
FT                   /note="Chlorophyllase; Region: Chlorophyllase; cl06316"
FT                   /db_xref="CDD:174865"
FT                   /locus_tag="Bcen_3020"
FT   misc_feature    complement(40587..41162)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_3020"
FT   gene            41753..42889
FT                   /db_xref="GeneID:4095273"
FT                   /locus_tag="Bcen_3021"
FT   CDS_pept        41753..42889
FT                   /locus_tag="Bcen_3021"
FT                   /gene_family="HOG000219242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107025379"
FT                   /db_xref="GeneID:4095273"
FT                   /translation="MRSLPNPMPARVALDAFRTLFEKAEGWRVVEEIAQDHVGDLILSN
FT                   DKGQTYVANLKTFNEGRADRVTALFAQALLEARAYAKRQKMRPAILIWVGSAPPSLIQR
FT                   LADFHAEFADREPFAVLSADGTRYVRFPGLDISEHPGQSTRSYSRSRSVQPGLAFSDLN
FT                   QWMLKLLLAIDIKRENLIGAEGRRYTTATDLARAADVSVMTATRLIHALKQEGFIETKP
FT                   FLKVVQRRKLAQRWKAEYLRQAAAVPMKFLVPAAPDVQLRKVLKNEGGTLGLFAAADAL
FT                   GVGHVSGVPPTVWVPSLMEAENWRPLRRAKEGERPDLVLQQPGFPQSLGRGVVYRDGLP
FT                   VTDIIQTWLDVSAHPARGAEQAAELEHGVLVNVTGEGA"
FT                   /protein_id="YP_622890.1"
FT   gene            42895..43731
FT                   /db_xref="GeneID:4095274"
FT                   /locus_tag="Bcen_3022"
FT   CDS_pept        42895..43731
FT                   /locus_tag="Bcen_3022"
FT                   /gene_family="HOG000219231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_I1932 hypothetical protein"
FT                   /db_xref="GI:107025380"
FT                   /db_xref="GeneID:4095274"
FT                   /translation="MADFSNLAMTLAPWRARIVFIGGWAFRLYSYEPRAWKPDHKPIFT
FT                   QDADVAYAEREVLEGDIKKALESAGFKEEPNFAGGFKPPAMRYTLGKQANGFYAEFLTP
FT                   LTGSLLRRNKVTRRMEQDATEANAGVVSQKLRHLEILLHEPWLVTIPAEESGCGDALVD
FT                   LRIPNPVSFMVQKLLIRDDRIPEKRAQDVLYIHDAMLLFGGAIEDELVPVWKRLEPTLS
FT                   DAQRRSLDAGVGAFFAEVNDTIRAAADIPRPDRQIEPEDLLRLCKNGFEALFGEVP"
FT                   /protein_id="YP_622891.1"
FT   misc_feature    42931..43542
FT                   /note="Protein of unknown function (DUF3620); Region:
FT                   DUF3620; cl02233"
FT                   /db_xref="CDD:154811"
FT                   /locus_tag="Bcen_3022"
FT   gene            complement(43754..44083)
FT                   /db_xref="GeneID:4095275"
FT                   /locus_tag="Bcen_3023"
FT   CDS_pept        complement(43754..44083)
FT                   /locus_tag="Bcen_3023"
FT                   /gene_family="HOG000219230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0305 hypothetical protein"
FT                   /db_xref="GI:107025381"
FT                   /db_xref="GeneID:4095275"
FT                   /translation="MDRIDITDHGRIAGHLIRGVTRAQKTFRPSDWPERLAGVITLFVG
FT                   ERRPGYPCALSRLAMPVVDGGVKCLFVSDELRAVCADAFEFAMQFAADNDLPVELQGVP
FT                   ALTVR"
FT                   /protein_id="YP_622892.1"
FT   misc_feature    complement(43772..44062)
FT                   /note="Protein of unknown function (DUF3579); Region:
FT                   DUF3579; pfam12112"
FT                   /db_xref="CDD:152547"
FT                   /locus_tag="Bcen_3023"
FT   gene            complement(44109..45470)
FT                   /db_xref="GeneID:4095276"
FT                   /locus_tag="Bcen_3024"
FT   CDS_pept        complement(44109..45470)
FT                   /locus_tag="Bcen_3024"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component, sigma54 specific, Fis family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; SMART: ATPase;
FT                   KEGG: bur:Bcep18194_B0306 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="GI:107025382"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4095276"
FT                   /translation="MEDEIRVLVVEDDENVRIGVEQAVALAGFPVDAFASAADALAHVA
FT                   PGAPVVIVSDVRMPGIDGLQLLDRVMAIDAQIPVVLISGHADISTAVGAMQVGAYDFIE
FT                   KPFSSDLIAGRVARAVEKRRLTLEVQGLRAALNNWQGIEAFVLGKSPAMADVRKKILRL
FT                   ADTSVSVLITGETGTGKELIARSLHDFGGRRDAHFVALNCGGLPEQVFESELFGHEAGA
FT                   FTGAIKKRIGKIEWADGGTLFLDEIETMPIALQIKMLRVLQERVVERLGANDLIPVDCR
FT                   VVAASKADLAELAADGRFRADLLYRLNVAQIELPPLRERREDVPLLFEHFVLAAARRFG
FT                   QPAPVVTAAQVSELMMHAWPGNVRELQNVADRFVLGLTGDSLLSSGGAPTAGSTLAEQL
FT                   AYFERMLIEDMLRRHNGNVADASEALGMPKKTLYHKLRNLRIPARGDAAADGGE"
FT                   /protein_id="YP_622893.1"
FT   misc_feature    complement(44148..45470)
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(45111..45449)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(order(45153..45158,45165..45167,45222..45224,
FT                   45282..45284,45306..45308,45435..45440))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(45306..45308)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(order(45282..45290,45294..45299))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(45150..45158)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(44547..45020)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(44928..44951)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(order(44595..44597,44736..44738,44925..44948))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(44733..44750)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(44553..44555)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcen_3024"
FT   misc_feature    complement(44160..44267)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Bcen_3024"
FT   gene            complement(45460..47364)
FT                   /db_xref="GeneID:4095277"
FT                   /locus_tag="Bcen_3025"
FT   CDS_pept        complement(45460..47364)
FT                   /locus_tag="Bcen_3025"
FT                   /gene_family="HOG000219219" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0307 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="GI:107025383"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4095277"
FT                   /translation="MRANVQKSFKGIPWWGWASAAVLYVGVAGAAVDFAWERAIDALEE
FT                   AGAHRLDLYASSLKSELGRFEILPGLVARQDGVRAMLKAAPNDAPELVHAVNTYLEAVN
FT                   RDAGSGAVDVIDLQGDVIAASNWNETISFVGTNVSYRPYFKDALARGSGRFFGIGTNTG
FT                   VPGVYFASAVRSDGVPIGVAAVKISVDPLESAWRAPGVAALVVDSNGVVVISTEPAWKF
FT                   TALRPITAQQQRDIQASRQYAGRTVDALPYRHIGDRSSAAWFGTFPDPRHAGRTTRYLV
FT                   MSRPAPQAGDSLMVLLDIAGARRQQQTAFVFVTGAFLIAALLAGYAIQRRRAILARLSA
FT                   QDALRRANDRLELTVAQRTAALTAANERMQREIDERERTEQRLRASQQEVVHAGKLAVL
FT                   GQMAAGLTHELNQPLVAIRTLCDNARTFFERGQPAPALANLERVGKLVDGMAVLTGELK
FT                   TFARKPDVERVAVSLNEAVAHARLIYDARIRDEGVRLDVNIAPGTTVSAESSQLQQVIV
FT                   NLLGNALDAVHDAPVRRIVIEAAETGDADDATNAGRVRLAVADSGAGIAPDVLPHLFEP
FT                   FVTTKPRGQGLGLGLAITSRIVEAFGARITATNRDEGGAQFTIEFAAATPQQRTEHGR"
FT                   /protein_id="YP_622894.1"
FT   sig_peptide     complement(47272..47364)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.835) with cleavage site probability 0.679 at
FT                   residue 31"
FT                   /locus_tag="Bcen_3025"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(45490..47268)
FT                   /note="Signal transduction histidine kinase regulating
FT                   C4-dicarboxylate transport system [Signal transduction
FT                   mechanisms]; Region: COG4191"
FT                   /db_xref="CDD:33926"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(45979..46179)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(order(45994..45996,46006..46008,46015..46017,
FT                   46027..46029,46036..46038,46048..46050,46105..46107,
FT                   46114..46116,46126..46128,46135..46137,46147..46149,
FT                   46159..46161))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(46141..46143)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(45502..45831)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(order(45514..45516,45520..45525,45538..45540,
FT                   45544..45546,45592..45603,45670..45675,45679..45681,
FT                   45685..45687,45691..45693,45790..45792,45799..45801,
FT                   45811..45813))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(45799..45801)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_3025"
FT   misc_feature    complement(order(45595..45597,45601..45603,45673..45675,
FT                   45679..45681))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_3025"
FT   gene            complement(47514..48923)
FT                   /db_xref="GeneID:4095278"
FT                   /locus_tag="Bcen_3026"
FT   CDS_pept        complement(47514..48923)
FT                   /locus_tag="Bcen_3026"
FT                   /gene_family="HOG000219208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="citrate carrier protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate carrier protein; KEGG:
FT                   bur:Bcep18194_B0308 citrate carrier protein"
FT                   /db_xref="GI:107025384"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="GeneID:4095278"
FT                   /translation="MPRSDAGIPNIRRHVLQTSIHTPSHPEPIAEAGPATRERFWPEGW
FT                   WKLMEIRIGIIPLPVYVILFGLIVGFAVTGKVPGEISMAIAVLAFFGFTCAELGKRLPL
FT                   LRNIGAAAIFATFVPSALTYYHVLPKPVLNLTVEFTKSTNFLYLFIASIIVGSILSMDR
FT                   RVLIQGFVKIFIPLAAGSVAAAIVGTAVGTALGLGARHTLLYIVVPIMAGGVGEGAIPL
FT                   SIGYSELMHLPQGEMFAMVLPPVMLGSLTAIILSGALDMLGKRLPHLTGNGRLQVGESG
FT                   DMMPENEEIRGHVDVTHIAGAGITAITLYLVGLMAHKLFGLPAPVAMLFLAVLVKLARA
FT                   VSPPLQEGAFVVYKFFSTAVTYPLLFAIGVAMTPWDKLTAAFTIVNVVTIVSTVATLMG
FT                   TGFVVGRLLKMYPIDTAIVNACHSGQGGTGDVAILTAANRMQLMPFAQIATRIGGAIVV
FT                   TVTLILVAHFG"
FT                   /protein_id="YP_622895.1"
FT   misc_feature    complement(47532..48770)
FT                   /note="2-hydroxycarboxylate transporter family; Region:
FT                   2HCT; cl01386"
FT                   /db_xref="CDD:154371"
FT                   /locus_tag="Bcen_3026"
FT   gene            49314..50087
FT                   /db_xref="GeneID:4095279"
FT                   /locus_tag="Bcen_3027"
FT   CDS_pept        49314..50087
FT                   /locus_tag="Bcen_3027"
FT                   /gene_family="HOG000222926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NLPA lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bur:Bcep18194_B0309
FT                   NlpA lipoprotein"
FT                   /db_xref="GI:107025385"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="GeneID:4095279"
FT                   /translation="MLHPVFSSRFSAGRVARLARLLTAALLGVVLLNGARADTAPLKVG
FT                   ISTSPQIEALKIAAKEAKEQGLDVKIVEFTDWNTPNAALANKDIDVNYFQHIPFLENAK
FT                   KQGGYNFISIAPGTIMKIGLYSKKVKSFAELKDGARVAIANDPVNGGRGLLLLQRAGLI
FT                   TLKPGADYRATTHDIVANPKHLKIIPLEASQLARSLDDVDLAQGYPSFIKLAGTTDPNS
FT                   ALLFDGTENKNFAIQWVVRPESANDPRIRKFISIY"
FT                   /protein_id="YP_622896.1"
FT   sig_peptide     49314..49427
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.960 at
FT                   residue 38"
FT                   /locus_tag="Bcen_3027"
FT                   /product="hypothetical protein"
FT   misc_feature    49437..50084
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_3027"
FT   gene            50164..51576
FT                   /db_xref="GeneID:4096155"
FT                   /locus_tag="Bcen_3028"
FT   CDS_pept        50164..51576
FT                   /locus_tag="Bcen_3028"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0310 flavin-dependent
FT                   oxidoreductase"
FT                   /db_xref="GI:107025386"
FT                   /db_xref="GeneID:4096155"
FT                   /translation="MTTANRKKILLNAFNMNCVGHINHGLWTHPRDRSAHYTDLDYWAD
FT                   LARTLERGKFDGIFLADIVGVYDVFGGGPDAALRESVQVPVNDPLLLVPAMAQVTRHLG
FT                   FGVTANLTYEPPYLFARRMSTLDHLTKGRVGWNIVTGYLDSAARGMGLAQQIGHDDRYE
FT                   RADDYMDVVYKLWEQSWDDDAVIRDAQARVFAQPGKVRRVKHDGPFYSIDAIHLSEPSL
FT                   QRTPVLYQAGSSARGVEFAGRHAECVFVNGQSKAAARAATLDIRAAAARQGRDPASIKI
FT                   FAGVSVVTAETELLAREKFDEYRRYASPEAGLAHFASSTGIDFAKYGLDEPISYVKTDS
FT                   IQSAVDAISRKSTTGTWTVRRMLEQMSLGGRYAPIVGSPSQVADELQSWIDETGIDGFN
FT                   LTRTVMPESFEDFVDWVVPELQNRGVYKEDYDPAPTLREKLFGVGPRLPAWHTGAQHRP
FT                   AAAAEPAHPAHA"
FT                   /protein_id="YP_622897.1"
FT   misc_feature    50194..51480
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="Bcen_3028"
FT   misc_feature    50194..51441
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="Bcen_3028"
FT   misc_feature    order(50209..50211,50221..50223,50392..50394,50578..50580,
FT                   50644..50646,50866..50871)
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="Bcen_3028"
FT   misc_feature    50485..50490
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="Bcen_3028"
FT   gene            51595..52779
FT                   /db_xref="GeneID:4096156"
FT                   /locus_tag="Bcen_3029"
FT   CDS_pept        51595..52779
FT                   /locus_tag="Bcen_3029"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0311 ABC metal ion transporter, ATPase
FT                   subunit"
FT                   /db_xref="GI:107025387"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4096156"
FT                   /translation="MTQLFDTLGFIEASAVRAGAGADAVAHEEAVTPVGGAAVSLEQVG
FT                   KVFATPRGQAAALRDVTLDVRRGEVFGIIGRSGAGKSTLLRLLNGLERPSSGRVRVQGV
FT                   DVGALDEDGLVALRRRTGMVFQHFNLLSAKTVFENVALPLKIAGVPKAERVRKVEALLE
FT                   LVGLAAKRDAYPASLSGGQKQRVGIARALVHDPEVLLCDEATSALDPETTQSILALLAD
FT                   INRRLGLTIVLITHEMEVIRAVCDTVAVIEQGEVVETGPVWRVFGDPRHGATRALLSTL
FT                   QHDLPAELAARVRPLPEQAALPDGAQIVLDVRYTGESGGEPDVGALAAALGGSVRFLHG
FT                   GIESIQGHAQGRLVIAATPRADDAGPSTARGGAVAALLERARRHANHAEVLGYV"
FT                   /protein_id="YP_622898.1"
FT   misc_feature    51709..52773
FT                   /note="ABC-type metal ion transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   AbcC; COG1135"
FT                   /db_xref="CDD:31330"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    51709..52404
FT                   /note="MetN (also known as YusC) is an ABC-type transporter
FT                   encoded by metN of the metNPQ operon in Bacillus subtilis
FT                   that is involved in methionine transport.  Other members of
FT                   this system include the MetP permease and  the MetQ
FT                   substrate binding protein...; Region:
FT                   ABC_MetN_methionine_transporter; cd03258"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    51817..51840
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    order(51826..51831,51835..51843,51970..51972,52198..52203,
FT                   52300..52302)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    51961..51972
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    52126..52155
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    52186..52203
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    52210..52221
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    52288..52308
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Bcen_3029"
FT   misc_feature    52510..52767
FT                   /note="NIL domain; Region: NIL; pfam09383"
FT                   /db_xref="CDD:150152"
FT                   /locus_tag="Bcen_3029"
FT   gene            52772..53428
FT                   /db_xref="GeneID:4096157"
FT                   /locus_tag="Bcen_3030"
FT   CDS_pept        52772..53428
FT                   /locus_tag="Bcen_3030"
FT                   /gene_family="HOG000222815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0312 ABC
FT                   metal ion transporter, inner membrane subunit"
FT                   /db_xref="GI:107025388"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4096157"
FT                   /translation="MFDLWWPELLDAIRDTLSMVAASAAIAALIGIPLAVILVTTAPGG
FT                   IYARRGVNAVLGALVNVFRSTPFIILLVALLPFTRVLIGTTIGVWAAVVPLSIAAIPFF
FT                   ARIAEVSLREVDRGLIEAALAMGAKRRHIVWHVLLPEALPGMLGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTTVMATVIVILIALVSAVQITGDRLVRRVTRRT"
FT                   /protein_id="YP_622899.1"
FT   misc_feature    52916..>53254
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3030"
FT   misc_feature    order(52937..52948,52952..52981,52988..52993,52997..52999,
FT                   53063..53068,53072..53074,53078..53080,53087..53092,
FT                   53096..53098,53108..53113,53120..53122,53171..53173,
FT                   53213..53218,53225..53227,53246..53254)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3030"
FT   misc_feature    order(52955..52999,53246..53254)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3030"
FT   misc_feature    order(53123..53161,53177..53182,53192..53194)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3030"
FT   gene            53480..54322
FT                   /db_xref="GeneID:4096158"
FT                   /locus_tag="Bcen_3031"
FT   CDS_pept        53480..54322
FT                   /locus_tag="Bcen_3031"
FT                   /gene_family="HOG000219187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0313 hypothetical protein"
FT                   /db_xref="GI:107025389"
FT                   /db_xref="GeneID:4096158"
FT                   /translation="MTLPIGAPREWNGQFEEALFLEVARRHRPDFPDKVATPPREPCNG
FT                   DELAAVADYYTKMASHDLFIVQVVAKAIDTLFRDDPHFQLILSRQLGDDGAHAVIGRER
FT                   VTELTGRDPLPEVDRLVAAHWARIGDIAVRDVAGFLAFEWHYELHILAKLWIQRKTGRI
FT                   GDSAMREHGENRIRPDEEWHRVQIVQWWFDTLQALPAAERDALIDRVIAADEETQARLD
FT                   GYLHDEYAHTALVFGADIAEYRAIYDDWRREILSRLTGRQLGALVPLSGETVEQEAVA"
FT                   /protein_id="YP_622900.1"
FT   gene            54319..55530
FT                   /db_xref="GeneID:4096159"
FT                   /locus_tag="Bcen_3032"
FT   CDS_pept        54319..55530
FT                   /locus_tag="Bcen_3032"
FT                   /gene_family="HOG000219186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase, type 2-like"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   bur:Bcep18194_B0314 acyl-CoA dehydrogenase-like"
FT                   /db_xref="GI:107025390"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:4096159"
FT                   /translation="MNDPRGPATLAPDTDAPAVDRAALARAIDALRVSAAERDRAGGHA
FT                   AREKQWLADAGLLTLAVPRAFGGQEAAWPEIYDAIRQVARVDSALAHLVGFQCLQVVSV
FT                   DVWGNAAQRERYLRGTVDRRWWWGNAVNPLDTRLVATATPDGGYRLDGVKGFCSGTRGS
FT                   QRMTVSAHDPAIGRTVFGVVPTDRAGITVNDDWDPVGQRQTDSGSVRFDGVTLAPDEVL
FT                   HRSEAPPTPRATLRTLVSQLVLTNLFVGLAEGALAEARDYVRQHGRPWIHSDVERAEDD
FT                   PYTLQRFGDMRVRAIAAAALADRAANTLQHAWARQDALTADERAEVALAVSEAKIVAQR
FT                   AALDNGEALFDACGARATAASLGLDRFWRNARTHTLHDPLDYRLRDVGRYALTGELPPA
FT                   SLYT"
FT                   /protein_id="YP_622901.1"
FT   misc_feature    54418..55509
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="Bcen_3032"
FT   misc_feature    54421..55512
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Bcen_3032"
FT   misc_feature    order(54784..54786,54790..54792)
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="Bcen_3032"
FT   gene            complement(55547..56356)
FT                   /db_xref="GeneID:4096160"
FT                   /locus_tag="Bcen_3033"
FT   CDS_pept        complement(55547..56356)
FT                   /locus_tag="Bcen_3033"
FT                   /gene_family="HOG000219161" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0315 hypothetical protein"
FT                   /db_xref="GI:107025391"
FT                   /db_xref="GeneID:4096160"
FT                   /translation="MKNKTLATLLLCAAAPGIALAQSIAAPALKPGDTWTYVDTVEIGP
FT                   NGWRQTRDEITVQRTTPGHIYVESRQSGATQAPHEMIVDADWSRARSINGTETVVNRPL
FT                   AFPLTIGKTWTIQYSESHPNPQHASEAYDTHYKVVGHETVTVTGGKFDAIKIEAEGSWK
FT                   AQSAPGQSITSGVSRNAGGSTIVVQSRNNGTAEGTGKTYKAFWYVPAVGRWVKSVEEYY
FT                   DTNGMRTARYSDELASYKRAGADGSAPLAGGPAPASVAPDGPPPGDQ"
FT                   /protein_id="YP_622902.1"
FT   sig_peptide     complement(56291..56356)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT                   /locus_tag="Bcen_3033"
FT                   /product="hypothetical protein"
FT   gene            56463..57734
FT                   /db_xref="GeneID:4096161"
FT                   /locus_tag="Bcen_3034"
FT   CDS_pept        56463..57734
FT                   /locus_tag="Bcen_3034"
FT                   /gene_family="HOG000182212" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /transl_table="11"
FT                   /note="PFAM: cobalamin synthesis protein, P47K; KEGG:
FT                   bur:Bcep18194_B0316 cobalamin synthesis protein/P47K"
FT                   /db_xref="GI:107025392"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="GeneID:4096161"
FT                   /translation="MLYRSDTIYHFISNVLFRNRPMNPALHPSTRLPVTVLSGFLGAGK
FT                   TTLLNHILNNREGRRVAVIVNDMSEVNIDAALVRDGGAGLSRTDEKLVEMSNGCICCTL
FT                   REDLLIEVDRLAREGRFDQLVIESTGISEPLPVAETFTFEGEDGRSLGEVARLDTMVTV
FT                   VDAFNFLRDYASRDSLQARGESMGDEDARTVVDLLIDQIEFCDVLVINKIDLIDASARE
FT                   RLIALLRGLNPRARIEIAEFGKVPLERVLDTGLFDFDAASRAPGWLQELRGTHTPETDE
FT                   YGIRSFVYRARRPFHPQRFFDLVESEWPGVVRSKGFFWLATHPTVAGSWSQAGAVARHG
FT                   PAGHWWAAVPPERWPRDAEAVAQIRARWDEHVGDARQELVLIGMDMDEPALRARFDACL
FT                   LTDAEMAAGPEHWTTWDNPFRDWA"
FT                   /protein_id="YP_622903.1"
FT   misc_feature    56556..57665
FT                   /note="Putative GTPases (G3E family) [General function
FT                   prediction only]; Region: COG0523"
FT                   /db_xref="CDD:30869"
FT                   /locus_tag="Bcen_3034"
FT   misc_feature    56559..57107
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:176936"
FT                   /locus_tag="Bcen_3034"
FT   misc_feature    57312..57659
FT                   /note="Cobalamin synthesis protein cobW C-terminal domain;
FT                   Region: CobW_C; cl08458"
FT                   /db_xref="CDD:158345"
FT                   /locus_tag="Bcen_3034"
FT   gene            57763..58713
FT                   /db_xref="GeneID:4096162"
FT                   /locus_tag="Bcen_3035"
FT   CDS_pept        57763..58713
FT                   /locus_tag="Bcen_3035"
FT                   /gene_family="HOG000247517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative GTP cyclohydrolase"
FT                   /transl_table="11"
FT                   /note="similar protein in Methanocaldococcus converts GTP
FT                   to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate as the
FT                   first step in methanopterin biosynthesis"
FT                   /db_xref="GI:107025393"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="GeneID:4096162"
FT                   /translation="MEKALHRISSMNAALPDISLTDAAPGRRPLEWVGMQGIDLPVVVA
FT                   EPGCRRDVHARADVQVDLPAPQVKGIHMSRLYGLLDGLADGEALSPAGLQRMLRAMVDS
FT                   HRDCETRSARVRLRFDLLARRTALVTEGLAGWKAYPVRLDATLAGDAFALRAQVTVVYS
FT                   STCPCSAALSRHWIEQAFLTAFGHEARVEPTAVAAWLKRHAMAATPHSQRSEAVVSVAL
FT                   PADGTTLGLLDLIDRVEQALGTPVQTAVKRADEQAFAVLNGGNLMFVEDAARRVQAALE
FT                   DRHASPRVRVRHLESLHPHDAVAWAAPLREGADAC"
FT                   /protein_id="YP_622904.1"
FT   misc_feature    57793..58701
FT                   /note="Uncharacterized ACR, COG1469; Region: DUF198;
FT                   cl00642"
FT                   /db_xref="CDD:174325"
FT                   /locus_tag="Bcen_3035"
FT   gene            58707..59285
FT                   /db_xref="GeneID:4096163"
FT                   /locus_tag="Bcen_3036"
FT   CDS_pept        58707..59285
FT                   /locus_tag="Bcen_3036"
FT                   /gene_family="HOG000219160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase-like"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0318
FT                   6-pyruvoyl-tetrahydropterin synthase-like"
FT                   /db_xref="GI:107025394"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="GeneID:4096163"
FT                   /translation="MLIRKLFRFENAHVVRGCSTRRCSHSIHGHSYRVELLLEAHALDH
FT                   GQMIYDFGLLKGDVRDLIDAFDHAVTLWSDDDPRYVESMRRHSERWVRLPVSPSAEQFS
FT                   RVFFRLVDAALCGTRMSNGEADVRLHSVIVHETETGYAQCFRDDAFNPRMGRIDLDAIV
FT                   FAPAIVAQWRDPGLFERLKRGHTLSRQKS"
FT                   /protein_id="YP_622905.1"
FT   misc_feature    58713..59144
FT                   /note="Tunnelling fold (T-fold). The five known T-folds are
FT                   found in five different enzymes with different functions:
FT                   dihydroneopterin-triphosphate epimerase (DHNTPE),
FT                   dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I
FT                   (GTPCH-1),  6-pyrovoyl...; Region: TFold; cl00263"
FT                   /db_xref="CDD:174076"
FT                   /locus_tag="Bcen_3036"
FT   gene            59285..59845
FT                   /db_xref="GeneID:4096164"
FT                   /locus_tag="Bcen_3037"
FT   CDS_pept        59285..59845
FT                   /locus_tag="Bcen_3037"
FT                   /gene_family="HOG000049430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbonic anhydrase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0319 carbonic
FT                   anhydrases/acetyltransferase isoleucine patch superfamily"
FT                   /db_xref="GI:107025395"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="GeneID:4096164"
FT                   /translation="MIRKNPRGDLPHIHPNAFVDPTAILCGRVIVEENVFIGPYAVIRA
FT                   DETDADGQIAPIVIGAHSNIQDGVVIHSKSGASVTIGRHTSIAHRAIVHGPCMVGDGVF
FT                   VGFNSVLFNCTIDDGCVVRYNAVVDGCHLPPGFHVRSTERIGPETDLAALPQVTADASE
FT                   FSEDVARTNNALVLGYKQIQNEF"
FT                   /protein_id="YP_622906.1"
FT   misc_feature    59285..59836
FT                   /note="Carbonic anhydrases/acetyltransferases, isoleucine
FT                   patch superfamily [General function prediction only];
FT                   Region: PaaY; COG0663"
FT                   /db_xref="CDD:31007"
FT                   /locus_tag="Bcen_3037"
FT   misc_feature    59309..59824
FT                   /note="Gamma carbonic anhydrases (CA): Carbonic anhydrases
FT                   are zinc-containing enzymes that catalyze the reversible
FT                   hydration of carbon dioxide in a two-step mechanism,
FT                   involving the nucleophilic attack of a zinc-bound hydroxide
FT                   ion on carbon dioxide...; Region: LbH_gamma_CA; cd00710"
FT                   /db_xref="CDD:100039"
FT                   /locus_tag="Bcen_3037"
FT   misc_feature    order(59336..59338,59342..59344,59348..59353,59360..59362,
FT                   59396..59398,59405..59410,59414..59416,59420..59422,
FT                   59483..59488,59498..59500,59549..59560,59564..59566,
FT                   59603..59605)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:100039"
FT                   /locus_tag="Bcen_3037"
FT   misc_feature    order(59498..59500,59549..59551,59564..59566)
FT                   /note="active site"
FT                   /db_xref="CDD:100039"
FT                   /locus_tag="Bcen_3037"
FT   gene            59849..61219
FT                   /db_xref="GeneID:4096165"
FT                   /locus_tag="Bcen_3038"
FT   CDS_pept        59849..61219
FT                   /locus_tag="Bcen_3038"
FT                   /gene_family="HOG000219143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="Catalyzes the reversible hydrolysis of the amide
FT                   bond within dihydroorotate. This metabolic intermediate is
FT                   required for the biosynthesis of pyrimidine nucleotides"
FT                   /db_xref="GI:107025396"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR005847"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:4096165"
FT                   /translation="MGERLRQEAGDRSTRRHADLLVHGGTVMTPNGAERIDVACMGGRV
FT                   VALGALHGTWSADVLLDARGLHVLPGVVDSQVHFREPGLTHKETIEAGTRGAVLGGVTT
FT                   IFEMPNTHPLTLDEQDLSAKLDLARGRAWCDYAFYIGGSAVNAERLPVLERLPGCAGVK
FT                   VFMGSSFGDLLADDETVLRRILRHGRRRMAVHAEDEARLRERKSIAEASGDVRDHPRWR
FT                   DAESALAATRRIVGLAAETGRRLHVLHVSTADEMALLARHRRRVTVEVTPHHLSLHAPD
FT                   CYERLGTFAQMNPPVRERHHRDALWQAVSDGVVDVIGSDHAPHTRDEKRRPYPQSPSGM
FT                   TGVQTLLPLMLDHVQAGRLSVERLVDLTSAGPARVFGIEGKGRIAAGYDADFSIVDLRA
FT                   RRIIRDEWIASVSGWTPYDGRAVTGWPVHTVVRGQVVVRDEALNGQPAGEAVTFLDP"
FT                   /transl_table="11"
FT                   /protein_id="YP_622907.1"
FT   misc_feature    59891..61213
FT                   /note="dihydroorotase; Validated; Region: PRK09060"
FT                   /db_xref="CDD:169640"
FT                   /locus_tag="Bcen_3038"
FT   misc_feature    59903..>60082
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="Bcen_3038"
FT   misc_feature    60041..61126
FT                   /note="Dihydroorotase (DHOase), subgroup IIb; DHOases
FT                   catalyze the reversible interconversion of carbamoyl
FT                   aspartate to dihydroorotate, a key reaction in pyrimidine
FT                   biosynthesis. This group contains the archeal members of
FT                   the DHOase family; Region: DHOase_IIb; cd01318"
FT                   /db_xref="CDD:30061"
FT                   /locus_tag="Bcen_3038"
FT   misc_feature    order(60074..60076,60080..60082,60431..60433,60593..60595,
FT                   60806..60808)
FT                   /note="active site"
FT                   /db_xref="CDD:30061"
FT                   /locus_tag="Bcen_3038"
FT   gene            complement(61216..61680)
FT                   /db_xref="GeneID:4096166"
FT                   /locus_tag="Bcen_3039"
FT   CDS_pept        complement(61216..61680)
FT                   /locus_tag="Bcen_3039"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   bur:Bcep18194_B0321 transcriptional regulator, AsnC family"
FT                   /db_xref="GI:107025397"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:4096166"
FT                   /translation="MPIKLDAIDRRILRALQQNSNQTNADIAQQAGLSPTPCLRRVHLL
FT                   EEQGVIDAYVALLNPAAVELRFTAFVRVTLERQDKTTVERFAREMEHAPEVLECHLMAG
FT                   SYDYLLRVIAKDLDNYQRFQMETLTQIEGVRNIETEIPLKRIKQTVRLPI"
FT                   /protein_id="YP_622908.1"
FT   misc_feature    complement(61219..61680)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Bcen_3039"
FT   misc_feature    complement(61339..61668)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3039"
FT   gene            61849..62475
FT                   /db_xref="GeneID:4096167"
FT                   /locus_tag="Bcen_3040"
FT   CDS_pept        61849..62475
FT                   /locus_tag="Bcen_3040"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine exporter protein LysE/YggA"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0322 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="GI:107025398"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:4096167"
FT                   /translation="MSHVAWLPFMATSLLIILTPGQDMVLVMSRTLSGGTRAGLVTAAG
FT                   VSVGLLVHTMLATLGLGALLQASEWLFTALKVVGALYLLYLGITLLRSSGELTLAGDGT
FT                   APASRLRTFAQGALSNVSNPKVALFYLAFLPQFVPAGAPHPMLSLFVLGATFAGLTFLV
FT                   KGPVALFAGLLSASIRRNPRILTRMHRVSGVVLLALGVKLALERR"
FT                   /protein_id="YP_622909.1"
FT   misc_feature    61849..62388
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Bcen_3040"
FT   gene            complement(62508..63356)
FT                   /db_xref="GeneID:4096168"
FT                   /locus_tag="Bcen_3041"
FT   CDS_pept        complement(62508..63356)
FT                   /locus_tag="Bcen_3041"
FT                   /gene_family="HOG000219131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix motif; KEGG:
FT                   bur:Bcep18194_B0324 transcriptional regulator, XRE family"
FT                   /db_xref="GI:107025399"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4096168"
FT                   /translation="MNSTAALHAPSPSAGRASGIGPLLRTWRQRRRLSQMALALDADVS
FT                   ARHLSFVESGRAQPSREMVLHLAERLDVPLRERNALLVAAGFAPLFRERPFSDPQLDAA
FT                   RHAVEAVLRGHEPYPALAVDRHWTLLAANRMLGTLVAQADPALLQPPVNVLRLSLHPDG
FT                   LASQIVNWHEWRAHILHRLQRQIDASGDRTLHALRDELAAYPAPAGQPDDSHTRTDFAD
FT                   IAVPLRLRTASGELTFFSTTTVFGTPVDVTLSELAIEAFFPANPETVEAMRALADALPV
FT                   A"
FT                   /protein_id="YP_622910.1"
FT   misc_feature    complement(<62997..63356)
FT                   /note="anaerobic benzoate catabolism transcriptional
FT                   regulator; Reviewed; Region: PRK08154"
FT                   /db_xref="CDD:169243"
FT                   /locus_tag="Bcen_3041"
FT   misc_feature    complement(63126..63296)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcen_3041"
FT   misc_feature    complement(order(63195..63197,63270..63272,63282..63284))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcen_3041"
FT   misc_feature    complement(order(63198..63200,63273..63275))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcen_3041"
FT   misc_feature    complement(order(63192..63197,63207..63209,63216..63218,
FT                   63249..63254))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcen_3041"
FT   gene            63494..64513
FT                   /db_xref="GeneID:4096169"
FT                   /locus_tag="Bcen_3042"
FT   CDS_pept        63494..64513
FT                   /locus_tag="Bcen_3042"
FT                   /gene_family="HOG000219110" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized membrane-anchored protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0325 uncharacterized
FT                   membrane-anchored protein"
FT                   /db_xref="GI:107025400"
FT                   /db_xref="GeneID:4096169"
FT                   /translation="MPGPDAAHIDNKAFQGNPTMKKLAVRLACVATLALAATSGHAQTE
FT                   AAQVEMRAAAAAANEAVVKGPTDIDVKHEAVLKLKAGESFVPAAEAGRYLRSMGNSIDE
FT                   AKLVGLVLPDDPDADWISVVSFEPSGYIRDDDAKDWKPDELLKSLQAGTEENNPARKER
FT                   GLPETEVVGWAKAPAYDAATHRLVWSAIIRDKGAAPNAANDGVNYRTLVLGRDGYLSLT
FT                   MASTLADLPKYQPSADALLSNIRFNDGKRYADFNQSTDHVAEYGLAALIVGVGAKKLGL
FT                   LALIGAFAVKFFKIGAVALLAGGAALKRFFGRKPKAAAAPAVADATAASDTAATERKE"
FT                   /protein_id="YP_622911.1"
FT   sig_peptide     63494..63622
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.861 at
FT                   residue 43"
FT                   /locus_tag="Bcen_3042"
FT                   /product="hypothetical protein"
FT   misc_feature    63683..64378
FT                   /note="Protein of unknown function (DUF2167); Region:
FT                   DUF2167; cl01938"
FT                   /db_xref="CDD:154664"
FT                   /locus_tag="Bcen_3042"
FT   gene            64510..65235
FT                   /db_xref="GeneID:4096170"
FT                   /locus_tag="Bcen_3043"
FT   CDS_pept        64510..65235
FT                   /locus_tag="Bcen_3043"
FT                   /gene_family="HOG000219099" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M50"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M50; KEGG: bur:Bcep18194_B0326
FT                   peptidase M50"
FT                   /db_xref="GI:107025401"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="GeneID:4096170"
FT                   /translation="MTKLLLLIFGGLKLGKVLVSAGTMLASIAVYALFYGWRFAAGFVA
FT                   LLLVHEAGHYVAAQRRGLDVGLPTFIPFVGAWIQLKEMPHDAETEAYVGLAGPFVGTLG
FT                   ALACYAAARHTDSNLLLALSYTGFFLNLFNMIPLSPFDGGRITAVLSPRIWLVGVPVLI
FT                   ALFVYRPSPLLIVMAILALPQLKRAWRYDPDAPENRVYYATSIETKTTYALCYVGLLAF
FT                   LALMTSGVHDMLRAVHAST"
FT                   /protein_id="YP_622912.1"
FT   sig_peptide     64510..64608
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.717) with cleavage site probability 0.657 at
FT                   residue 33"
FT                   /locus_tag="Bcen_3043"
FT                   /product="hypothetical protein"
FT   misc_feature    64606..65055
FT                   /note="Uncharacterized homologs of Site-2 protease (S2P),
FT                   zinc metalloproteases (MEROPS family M50) which cleave
FT                   transmembrane domains of substrate proteins, regulating
FT                   intramembrane proteolysis (RIP) of diverse signal
FT                   transduction mechanisms. Members of the...; Region:
FT                   S2P-M50_like_2; cd06160"
FT                   /db_xref="CDD:100081"
FT                   /locus_tag="Bcen_3043"
FT   misc_feature    order(64657..64662,64669..64671,64909..64911,64933..64935)
FT                   /note="active site"
FT                   /db_xref="CDD:100081"
FT                   /locus_tag="Bcen_3043"
FT   misc_feature    64909..64920
FT                   /note="putative substrate binding region; other site"
FT                   /db_xref="CDD:100081"
FT                   /locus_tag="Bcen_3043"
FT   gene            complement(65302..66696)
FT                   /db_xref="GeneID:4096171"
FT                   /locus_tag="Bcen_3044"
FT   CDS_pept        complement(65302..66696)
FT                   /locus_tag="Bcen_3044"
FT                   /gene_family="HOG000113642" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-galactonate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: D-galactonate transporter; PFAM: General
FT                   substrate transporter; KEGG: bur:Bcep18194_B0327
FT                   D-galactonate transporter"
FT                   /db_xref="GI:107025402"
FT                   /db_xref="InterPro:IPR004744"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096171"
FT                   /translation="MSNQTSPRDLPLDLARTARRTAVRYWILAMLFVVTTLNYADRATL
FT                   SITGTPIRKAFGIDPVTMGYIFSAFSWAYVLAQLPSGWLLDRFGARRVYAASIFLWSAF
FT                   TLLQSTIGLGGSAAFAVAALFAMRFAVGIAEAPAFPANAKVVASWFPTAERGTASAIFN
FT                   AAQYFAAVVFSPLMAWLTHAYGWHQVYLWLGLAGIALAFLWLRVVKDPADHPAVNRAEL
FT                   DHIEQGGGLVRSTGGATGARGSGGGASEGSRVAGWYYVRQLLSNRMLIGVYLGQYCVNV
FT                   LTYFFLTWFPIYLVQARGMSLLKAGFMTSLPAICGFLGGVLGGMLSDALIRRGVSLTLA
FT                   RKIPIVGGMLLSMVIIGCNYVDSEALVIMLMAVSFFGKGIGSLGWAVVADTAPKEAIGL
FT                   SGSLFNMFGNTAGIVAPIAIGYLVGASGSFNGALVFVGLNALVTVFSYLVIVKDIKRVE
FT                   LRHRDA"
FT                   /protein_id="YP_622913.1"
FT   misc_feature    complement(<66070..66615)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3044"
FT   misc_feature    complement(65344..66600)
FT                   /note="d-galactonate transporter; Region: 2A0114;
FT                   TIGR00893"
FT                   /db_xref="CDD:162094"
FT                   /locus_tag="Bcen_3044"
FT   misc_feature    complement(order(66187..66189,66205..66210,66217..66222,
FT                   66256..66258,66265..66270,66277..66282,66289..66294,
FT                   66451..66456,66460..66465,66475..66477,66484..66489,
FT                   66496..66498,66547..66552,66556..66564,66571..66573))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3044"
FT   misc_feature    complement(65347..>65898)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3044"
FT   gene            66944..68521
FT                   /db_xref="GeneID:4096172"
FT                   /locus_tag="Bcen_3045"
FT   CDS_pept        66944..68521
FT                   /locus_tag="Bcen_3045"
FT                   /gene_family="HOG000173382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0328 aldehyde dehydrogenase"
FT                   /db_xref="GI:107025403"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4096172"
FT                   /translation="MQLTGEMLIGAEAVAGSAGTLHAFDPTKGAPIEAPAFGVATQADV
FT                   DRACELARDAFDAYRTQPLAARAAFLEAIADEIVALGDALIERAHAETGLPVARLQGER
FT                   GRTVGQLRLFARVVRDGRFLAASIDPAQPARTPLPRSDLRLQKIALGPVAVFGASNFPL
FT                   AFSVAGGDTASALAAGCPVIVKAHEAHLGTSELVGRAIRAAVAKTGMPAGVFSLLVGPG
FT                   RVIGAALVSHPAVQAVGFTGSRQGGMALVQLANARPQPIPVYAEMSSINPVVLFPAALA
FT                   ARGDAIATGFVDSLTLGVGQFCTNPGLVLAIDGPDLDRFETVAAQALAKKPAGVMLTRG
FT                   IADAYRNGRGKLAELPGVREIGAGEAAQTDCQAGGALYEVGAQAFLGEPAFSHEVFGPA
FT                   SLIVRCRDLDEVARVLDALEGQLTATLQMDADDKPLARRLLPILERKAGRLLVNGYPTG
FT                   VEVCDAMVHGGPFPATSNPAVTSVGATAIERFLRPVCYQDFPDDLLPEGLREGNPLAIP
FT                   RLRDGKAE"
FT                   /protein_id="YP_622914.1"
FT   misc_feature    67076..68437
FT                   /note="Alpha-Ketoglutaric Semialdehyde Dehydrogenase;
FT                   Region: ALDH_KGSADH; cd07129"
FT                   /db_xref="CDD:143447"
FT                   /locus_tag="Bcen_3045"
FT   misc_feature    order(67112..67114,67124..67126,67328..67330,67370..67372,
FT                   67376..67378,67685..67687,67694..67696,68189..68191,
FT                   68252..68254,68264..68266,68276..68278,68282..68293,
FT                   68297..68299,68321..68323,68336..68341,68351..68356,
FT                   68414..68419,68423..68434)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143447"
FT                   /locus_tag="Bcen_3045"
FT   misc_feature    order(67418..67420,67496..67498,67502..67507,67622..67624,
FT                   67661..67663,67670..67672,67679..67681)
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:143447"
FT                   /locus_tag="Bcen_3045"
FT   misc_feature    order(67421..67423,67739..67741,67841..67843,67850..67852)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143447"
FT                   /locus_tag="Bcen_3045"
FT   gene            complement(68649..69020)
FT                   /db_xref="GeneID:4096173"
FT                   /locus_tag="Bcen_3046"
FT   CDS_pept        complement(68649..69020)
FT                   /locus_tag="Bcen_3046"
FT                   /gene_family="HOG000219088" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT protein-like"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein-like; KEGG: bur:Bcep18194_B0329
FT                   PilT protein-like"
FT                   /db_xref="GI:107025404"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:4096173"
FT                   /translation="MILVDTSVWIDHLRAGDATLTALLEAERVLIHPFIVGELALGSMR
FT                   HRETVLDALRDLPAATLATDDEVQRMIDAVPLHGLGIGYVDAHLLASARLTSDSRLWTR
FT                   DRRLLAAAERLQLVARPAH"
FT                   /protein_id="YP_622915.1"
FT   misc_feature    complement(68706..69017)
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:175014"
FT                   /locus_tag="Bcen_3046"
FT   gene            complement(69017..69214)
FT                   /db_xref="GeneID:4096174"
FT                   /locus_tag="Bcen_3047"
FT   CDS_pept        complement(69017..69214)
FT                   /locus_tag="Bcen_3047"
FT                   /gene_family="HOG000219077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0330 hypothetical protein"
FT                   /db_xref="GI:107025405"
FT                   /db_xref="GeneID:4096174"
FT                   /translation="MRTTLSLDDALLAKAQQLTGVTEKSALVREALRALIARESARRLA
FT                   RLGGTEPDLESVPRRPSEPA"
FT                   /protein_id="YP_622916.1"
FT   misc_feature    complement(69074..>69157)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2191); Region: DUF2191; cl02270"
FT                   /db_xref="CDD:154830"
FT                   /locus_tag="Bcen_3047"
FT   gene            69400..69954
FT                   /db_xref="GeneID:4096044"
FT                   /locus_tag="Bcen_3048"
FT   CDS_pept        69400..69954
FT                   /locus_tag="Bcen_3048"
FT                   /gene_family="HOG000219066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0331 hypothetical protein"
FT                   /db_xref="GI:107025406"
FT                   /db_xref="GeneID:4096044"
FT                   /translation="MNISKRGDHLFAAGLWKAIGDVAKSVRTQIGETSEGRVLADALFA
FT                   LQRELGGSEFDVTINQGRPVAGSDPHSVIFGRAVERFKQDMEAVVFALKHRRSIDGPNG
FT                   AERADALTQANTHLATAKQYAMFTVGRFFDAVVDRDVLEQIVGAESPARGRPLAARKGI
FT                   DETQRTLTGVRQRIIGAIAQM"
FT                   /protein_id="YP_622917.1"
FT   gene            complement(70069..70983)
FT                   /db_xref="GeneID:4096045"
FT                   /locus_tag="Bcen_3049"
FT   CDS_pept        complement(70069..70983)
FT                   /locus_tag="Bcen_3049"
FT                   /gene_family="HOG000173605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /EC_number="4.2.1.41"
FT                   /note="catalyzes the formation of 2,5-dioxopentanoate from
FT                   5-dehydro-4-deoxy-D-glucarate"
FT                   /db_xref="GI:107025407"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="GeneID:4096045"
FT                   /translation="MTSPQELKQIISHGLLSFPLTDFDADGSFRPSTYAERLEWLAPYG
FT                   ASALFAAGGTGEFFSLTQREYSDVIRVATETCKGKVPILAGAGGATRVAIEYAQEAERL
FT                   GASGVLLMPHYLTEASQEGIADHVEQVCRALKIGVVVYNRANSKLNADMLERLADRCPN
FT                   LIGFKDGVGEIESMVTIRRRLGDRFAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPK
FT                   TAMAFYEAIAKDDHATVGRLIDEFFLPYLKIRNRRAGYAVSIVKAGAKLVGHDAGPVRA
FT                   PLVDLTDEEAAELDVLIKKMGPQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_622918.1"
FT   misc_feature    complement(70102..70947)
FT                   /note="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase [Amino acid transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane]; Region: DapA; COG0329"
FT                   /db_xref="CDD:30677"
FT                   /locus_tag="Bcen_3049"
FT   misc_feature    complement(70084..70944)
FT                   /note="5-dehydro-4-deoxyglucarate dehydratase, also called
FT                   5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is
FT                   member of dihydrodipicolinate synthase (DHDPS) family that
FT                   comprises several pyruvate-dependent class I aldolases. The
FT                   enzyme is involved in...; Region: KDGDH; cd00951"
FT                   /db_xref="CDD:29944"
FT                   /locus_tag="Bcen_3049"
FT   misc_feature    complement(order(70405..70407,70480..70482,70552..70554,
FT                   70558..70560,70819..70824))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29944"
FT                   /locus_tag="Bcen_3049"
FT   misc_feature    complement(70480..70482)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29944"
FT                   /locus_tag="Bcen_3049"
FT   gene            71213..72766
FT                   /db_xref="GeneID:4096046"
FT                   /locus_tag="Bcen_3050"
FT   CDS_pept        71213..72766
FT                   /locus_tag="Bcen_3050"
FT                   /gene_family="HOG000219063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate
FT                   hydrolase-like; KEGG: bur:Bcep18194_B0333 galactarate
FT                   dehydratase"
FT                   /db_xref="GI:107025408"
FT                   /db_xref="InterPro:IPR007389"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="GeneID:4096046"
FT                   /translation="MTASPLYIRVHPDDNVAIVVNDGGLPAGATFADGLTLGEGVPQGH
FT                   KVALVDLAAGDPVIRYNVVIGYALTDLRRGSWVNERTMRMPEPPGLDDLPLATRAAPPL
FT                   EPLEGYTFEGFRNADGSVGTRNILAITTTVQCVSGVVEHAVKRIKDELLPRYPNVDDVV
FT                   GLEHTYGCGVAIDAPDADIPIRTLRNISLNPNFGGEVMTVSLGCEKLQPERLLPPGAIP
FT                   VTADGATDNGGVVCLQDAAHVGFNSMIDSIMTMAESHLERLNRRRRETCPASDLVVGVQ
FT                   CGGSDAFSGLTANPAVGFAADLLVRAGATIMFSEVTEVRDGVAQLTSRAANEEVAREII
FT                   REMDWYDRYLERGRVDRSANTTPGNKKGGLSNIVEKAMGSIVKSGSAPIAGVVRPGDRA
FT                   RQKGLLYAATPASDFICGTLQLAAGMNLHIFTTGRGTPYGLAQVPVIKVATRSDLARRW
FT                   HDLMDLDAGQIATGAATIEDTGWALFRLMLDVASGKRRTWAEQWKLANALTLFNPAPVT
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_622919.1"
FT   misc_feature    71228..72763
FT                   /note="galactarate dehydratase; Region: galactar-dH20;
FT                   TIGR03248"
FT                   /db_xref="CDD:132292"
FT                   /locus_tag="Bcen_3050"
FT   misc_feature    71534..72763
FT                   /note="SAF domain; Region: SAF; cl00555"
FT                   /db_xref="CDD:174283"
FT                   /locus_tag="Bcen_3050"
FT   gene            complement(72852..73334)
FT                   /db_xref="GeneID:4096047"
FT                   /locus_tag="Bcen_3051"
FT   CDS_pept        complement(72852..73334)
FT                   /locus_tag="Bcen_3051"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   cps:CPS_4919 transcriptional regulator, AsnC family"
FT                   /db_xref="GI:107025409"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:4096047"
FT                   /translation="MNSIAAPLDDFDLRILARLQHDNQITNQALAAEIGLSPPACLRRV
FT                   KRLRDERYIQQDVAVVDPNKVGLPLTMLVLVQVERERVDLLDEFKRFLKSLPEVMQCYV
FT                   VTGRADFVLMIAMRDIDHYEEFSTRVFRQHHNIRHFETMVVMSRVKVGLSLPIGIE"
FT                   /protein_id="YP_622920.1"
FT   misc_feature    complement(72864..73319)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Bcen_3051"
FT   misc_feature    complement(72987..73313)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3051"
FT   gene            73461..74591
FT                   /db_xref="GeneID:4096048"
FT                   /locus_tag="Bcen_3052"
FT   CDS_pept        73461..74591
FT                   /locus_tag="Bcen_3052"
FT                   /gene_family="HOG000130991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   eba:ebA3175 putative amino acid ABC transporter"
FT                   /db_xref="GI:107025410"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:4096048"
FT                   /translation="MRSRHLLLALAPLVLAVSAFGADTVVVGFAGALTGAQAHFGEDSA
FT                   RGIRLAIDEINAGHPSVAGHPVTFALDAQDDQADPKVATTVAQRFVDTHVSAVIGHQNS
FT                   GTSIAVARLYATANIAELTPSATNPEFTRLGYRTTFRLLANDDFLGQAVARYAVEQLHA
FT                   RRIGVVDDRTAYGQGIADVFVGGLGASGATVVAREYTTDKAFDFGAPLTLLKGKAPDAI
FT                   FFGGMDTQGGPMLKQMRKLRIAAPLLGGDGLCTHEILKLAGDALDGNLVCADGGRSLAK
FT                   MPGGPAFAARFTQKYGAPVQLYAPYAYDAMMAVYHAVMLAQSTDPAKIVDALHRVDFQG
FT                   VTGRIAFDARGELRNPAATISTFKGGNKVTLSEVVK"
FT                   /protein_id="YP_622921.1"
FT   sig_peptide     73461..73526
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT                   /locus_tag="Bcen_3052"
FT                   /product="hypothetical protein"
FT   misc_feature    73524..74564
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Bcen_3052"
FT   misc_feature    73536..74549
FT                   /note="Type I periplasmic ligand-binding domain of ABC
FT                   (Atpase Binding Cassette)-type active transport systems
FT                   that are involved in the transport of all three branched
FT                   chain aliphatic amino acids (leucine, isoleucine and
FT                   valine); Region: PBP1_ABC_LIVBP_like; cd06342"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3052"
FT   misc_feature    order(73557..73559,73584..73586,73596..73598,73605..73607,
FT                   74166..74168,74229..74231,74238..74240,74247..74252,
FT                   74346..74348)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3052"
FT   misc_feature    order(73764..73772,73833..73838,73983..73985,74139..74141,
FT                   74211..74213)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3052"
FT   gene            74588..76078
FT                   /db_xref="GeneID:4096049"
FT                   /locus_tag="Bcen_3053"
FT   CDS_pept        74588..76078
FT                   /locus_tag="Bcen_3053"
FT                   /gene_family="HOG000051151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase, class IV"
FT                   /transl_table="11"
FT                   /note="PFAM: formylmethionine deformylase; KEGG:
FT                   mlo:mlr1594 branched-chain amino acid transferase"
FT                   /db_xref="GI:107025411"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="GeneID:4096049"
FT                   /translation="MNTRILPVGTASLRDVARPVDDVGTPAVREAASALRAALRAFRDE
FT                   HGFGRAVAAPQIGIGQRMIALALDGWPDVIVNPEIVWRSDARMTLWDDCMCFPDLFVRV
FT                   ERHASVSVRYTTLDGEPHQRDALSPDVSELMQHEIDHLDGKLSFDRATGPNAVVHRSVF
FT                   DADRASFAAQVDYTPNVPRETRSAHHGIPSVEAPAFPQGAAYMNGRFIPIADARVSVLD
FT                   WGFLHSDVTYDTVHVWNGRFFRLDKHIERFRRSLARLRLNVPLTDDALRDILVECVRRS
FT                   GLRHAYVEMLCTRGVSPTFSRDPRDAVNQFIAFAVPYGSVANERQLREGLHLHVIDDVR
FT                   RIPPESVDPQIKNYHWLDLVAGLLKGYDAGAESVLLKCTDGSIAEGPGFNVFVVRDGRL
FT                   RTPERGVLHGITRQTVFELATAMGIDAQAARIDDAQLRDADEVFITSTAGGIMPVTRLN
FT                   DATIGDGRPGPMTRRLFDAYWAKHGDPAWSLAVDYADG"
FT                   /protein_id="YP_622922.1"
FT   misc_feature    74600..75025
FT                   /note="Polypeptide or peptide deformylase; a family of
FT                   metalloenzymes that catalyzes the removal of the N-terminal
FT                   formyl group in a growing polypeptide chain following
FT                   translation initiation during protein synthesis in
FT                   prokaryotes. These enzymes utilize Fe(...; Region:
FT                   Pep_deformylase; cl00234"
FT                   /db_xref="CDD:174055"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(74726..74734,74753..74755,74864..74872,74996..75001,
FT                   75008..75010)
FT                   /note="active site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(74732..74734,74753..74755,74870..74872,74999..75001)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(74867..74869,74996..74998,75008..75010)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    75200..76021
FT                   /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
FT                   (PLPDE_IV). This D-amino acid superfamily, one of five
FT                   classes of PLPDE, consists of branched-chain amino acid
FT                   aminotransferases (BCAT), D-amino acid transferases (DAAT),
FT                   and 4-amino-4-deoxychorismate...; Region: PLPDE_IV;
FT                   cl00224"
FT                   /db_xref="CDD:174046"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(75257..75262,75266..75271,75275..75277,75281..75283,
FT                   75359..75361,75452..75454,75458..75460,75524..75526,
FT                   75647..75649,75659..75661,75665..75667,75677..75679,
FT                   75719..75721)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:29567"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(75281..75283,75338..75340,75641..75643,75740..75742,
FT                   75815..75820,75926..75928)
FT                   /note="substrate-cofactor binding pocket; other site"
FT                   /db_xref="CDD:29567"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    75314..76021
FT                   /note="Aminotransferase class IV; Region: Aminotran_4;
FT                   pfam01063"
FT                   /db_xref="CDD:144598"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    order(75338..75340,75641..75643,75740..75742)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:29567"
FT                   /locus_tag="Bcen_3053"
FT   misc_feature    75641..75643
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29567"
FT                   /locus_tag="Bcen_3053"
FT   gene            76213..76605
FT                   /db_xref="GeneID:4096050"
FT                   /locus_tag="Bcen_3054"
FT   CDS_pept        76213..76605
FT                   /locus_tag="Bcen_3054"
FT                   /gene_family="HOG000219052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0334 hypothetical protein"
FT                   /db_xref="GI:107025412"
FT                   /db_xref="GeneID:4096050"
FT                   /translation="MNTAQTASSVHADLIDRYFDAWNEPDAARRRELIDATYASDAAYR
FT                   DPLMAGDGHAGIDTMIAAVQQRFPAYRFRRTTDVDAFGQHLRFSWALVSPDGAAIVKGS
FT                   DFGTVDASGRLASVTGFIDEMPAAAS"
FT                   /protein_id="YP_622923.1"
FT   gene            76618..77139
FT                   /db_xref="GeneID:4096051"
FT                   /locus_tag="Bcen_3055"
FT   CDS_pept        76618..77139
FT                   /locus_tag="Bcen_3055"
FT                   /gene_family="HOG000219041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RbsD or FucU transport"
FT                   /transl_table="11"
FT                   /note="PFAM: RbsD or FucU transport; KEGG:
FT                   bur:Bcep18194_B0335 RbsD or FucU transport associated
FT                   protein"
FT                   /db_xref="GI:107025413"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="GeneID:4096051"
FT                   /translation="MHHGRRDRVTLCDSFLIPETTDMLKNLDPLLHADILHTLRAMGHG
FT                   DEIAICDANFPAESVAEHTVVGRALRVDGADSARVVRAVLSVLPLDTFVDTPAWRMEVV
FT                   GDAAAVPPVQREVQAEIDRAEGRAVPLTGVERFAFYERAQQAYAVIVTGETRGYGCFIF
FT                   KKGVLLSDAG"
FT                   /protein_id="YP_622924.1"
FT   misc_feature    76684..77130
FT                   /note="RbsD / FucU transport protein family; Region:
FT                   RbsD_FucU; cl00809"
FT                   /db_xref="CDD:174400"
FT                   /locus_tag="Bcen_3055"
FT   gene            77327..77764
FT                   /db_xref="GeneID:4096052"
FT                   /locus_tag="Bcen_3056"
FT   CDS_pept        77327..77764
FT                   /locus_tag="Bcen_3056"
FT                   /gene_family="HOG000198398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DoxX"
FT                   /transl_table="11"
FT                   /note="PFAM: DoxX; KEGG: bur:Bcep18194_B0336 DoxX family
FT                   membrane protein"
FT                   /db_xref="GI:107025414"
FT                   /db_xref="InterPro:IPR011592"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="GeneID:4096052"
FT                   /translation="MTRTVDSGVIFFARLALAALFLWGGIMKLLGYSDFIAYLHGMNVP
FT                   YQQVVGPIVVAIEGLGGLLLIVGYKVRPLALLMAVYTIATAMVGHNFWDATNAAVQHDM
FT                   VIHFWKNVAIAGGFLLLFVTGAGGASIDALRRPSSSYGVLR"
FT                   /protein_id="YP_622925.1"
FT   misc_feature    77393..77746
FT                   /note="DoxX; Region: DoxX; cl00976"
FT                   /db_xref="CDD:154119"
FT                   /locus_tag="Bcen_3056"
FT   gene            complement(77868..79244)
FT                   /db_xref="GeneID:4096053"
FT                   /locus_tag="Bcen_3057"
FT   CDS_pept        complement(77868..79244)
FT                   /locus_tag="Bcen_3057"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0337 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107025415"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096053"
FT                   /translation="MPKSGPWRRSTNNYIRKPIVLTMQASELSGVPRAAERALTRSDYK
FT                   TLGLAALGGALEFYDFIIFVFFAPAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGG
FT                   VIMAHFGDLFGRKRMFTLSVLMMSVPTLLMGLLPTYDTIGILAPVLLLLFRVLQGAAVG
FT                   GEVPGAWVFVSEHVPSRHIGYACGTLTAGLTAGILLGSLVAAGINSRYSAAEVGAFAWR
FT                   IPFLLGGVLGLFSVYLRRWLHETPVFAEMKAKKALAAEIPLKAVLRDHGRAVIVSMLLT
FT                   WMLSAAIVVVILMTPALLQKQFHLTPATTLFANSIATLCLTAGCITAGSLAGWIGAKRV
FT                   LAIGGIGLAACYYLLFVQVAADASTLPLYYGIAGFMVGTIGAVPFVMVKSFPAVVRFSG
FT                   ISFSYNVAYAIFGGLTPVIVSLMMKSNPLAPVVYVAAICVLGAIAVQFSKDAKDVKGTH
FT                   "
FT                   /protein_id="YP_622926.1"
FT   misc_feature    complement(77922..79076)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="Bcen_3057"
FT   misc_feature    complement(77910..79073)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3057"
FT   misc_feature    complement(order(78009..78011,78018..78023,78030..78035,
FT                   78045..78050,78081..78083,78090..78095,78105..78107,
FT                   78114..78119,78126..78128,78270..78272,78282..78284,
FT                   78291..78293,78303..78305,78315..78317,78357..78359,
FT                   78366..78371,78378..78383,78390..78392,78654..78656,
FT                   78672..78677,78684..78689,78723..78725,78732..78737,
FT                   78744..78749,78756..78761,78921..78926,78930..78935,
FT                   78945..78947,78954..78959,78966..78968,79029..79034,
FT                   79038..79046,79053..79055))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3057"
FT   gene            complement(79500..80678)
FT                   /db_xref="GeneID:4096054"
FT                   /locus_tag="Bcen_3058"
FT   CDS_pept        complement(79500..80678)
FT                   /locus_tag="Bcen_3058"
FT                   /gene_family="HOG000130991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B0339 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="GI:107025416"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:4096054"
FT                   /translation="MPAAAQPRHQGEVKVKLKVSHVALAAACALSGAHAVAADVVKIGF
FT                   AAPLTGPQSNYGTDMQKGVQLAIADFNATHPTIGGKPVTFQLDSQDDQADPRTGTTVAQ
FT                   RLIDDNVRGIIGHFNSGTSIPASDLYDRAGLPQISMATSPQYTARGYKTTYRLLTSDAQ
FT                   AGRIVGTYAVKTLRFKRIAIIDDRTAYGQGIADEFAKAVEAAGGTIVKRDFTNDKALDF
FT                   SAILTNLKGVNPDAVFYGGGDAQSSPMIRKMRQLGMKSAFVTGEMSRSPTFLKVGGDAA
FT                   EGAIVYMGGLPKEKMPGFSGYAARYKARFNEDVITYSPYSYDGTIALLTAMKDANSTDP
FT                   KVYTPYLGKVSIKGVSAPSIAYDPKGDLKDAPVTIYKVERGAFKPVDTIAGN"
FT                   /protein_id="YP_622927.1"
FT   sig_peptide     complement(80565..80678)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.694 at
FT                   residue 38"
FT                   /locus_tag="Bcen_3058"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(79533..80564)
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Bcen_3058"
FT   misc_feature    complement(79545..80555)
FT                   /note="Type I periplasmic ligand-binding domain of ABC
FT                   (Atpase Binding Cassette)-type active transport systems
FT                   that are involved in the transport of all three branched
FT                   chain aliphatic amino acids (leucine, isoleucine and
FT                   valine); Region: PBP1_ABC_LIVBP_like; cd06342"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3058"
FT   misc_feature    complement(order(79749..79751,79842..79847,79854..79856,
FT                   79863..79865,79926..79928,80484..80486,80493..80495,
FT                   80505..80507,80532..80534))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3058"
FT   misc_feature    complement(order(79881..79883,79953..79955,80109..80111,
FT                   80256..80258,80319..80327))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107337"
FT                   /locus_tag="Bcen_3058"
FT   gene            complement(80862..81113)
FT                   /db_xref="GeneID:4096055"
FT                   /locus_tag="Bcen_3059"
FT   CDS_pept        complement(80862..81113)
FT                   /locus_tag="Bcen_3059"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0340 hypothetical protein"
FT                   /db_xref="GI:107025417"
FT                   /db_xref="GeneID:4096055"
FT                   /translation="MHATASQYLRGRRPFRFRHGRRSASTHRHHAPGLAILKMPAPRVL
FT                   AGLRIRHDDFGIYQGNRRYADIVAGHASNAQDACIFAP"
FT                   /protein_id="YP_622928.1"
FT   gene            81256..82050
FT                   /db_xref="GeneID:4096056"
FT                   /locus_tag="Bcen_3060"
FT   CDS_pept        81256..82050
FT                   /locus_tag="Bcen_3060"
FT                   /gene_family="HOG000219028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0341 transcriptional regulator, AraC family"
FT                   /db_xref="GI:107025418"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="GeneID:4096056"
FT                   /translation="MTTLLAVPPMSLSDTLRDPPDNADFGAMLAHFRLLEPVFDALPDV
FT                   AFFVKDASGRYALVNRTLAMRCGYKDKRDLLGKTADEVFPRRFGRSYFEQDMATINAGQ
FT                   QLMDQLELHLYPGRQPGWCLTCKEPLRDAAGGVVGLAGISRDLKAHEGSHPAYSRLADV
FT                   VQHIQDHYVQPLNLKQLAQMAGMSVAQLERYFHKVFHLTPRQVLLKTRLDAATALLVTH
FT                   DKVTDVAALCGYTDHSAFTRQFKATVGVTPTEYRLMLQERAG"
FT                   /protein_id="YP_622929.1"
FT   misc_feature    81370..81696
FT                   /note="PAS fold; Region: PAS_4; pfam08448"
FT                   /db_xref="CDD:117025"
FT                   /locus_tag="Bcen_3060"
FT   misc_feature    81673..82044
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bcen_3060"
FT   misc_feature    <81925..82026
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcen_3060"
FT   gene            complement(82136..82399)
FT                   /db_xref="GeneID:4096057"
FT                   /locus_tag="Bcen_3061"
FT   CDS_pept        complement(82136..82399)
FT                   /locus_tag="Bcen_3061"
FT                   /gene_family="HOG000219007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0342 hypothetical protein"
FT                   /db_xref="GI:107025419"
FT                   /db_xref="GeneID:4096057"
FT                   /translation="MSAVEAPAGRPAAPPAKKTMLRRLLSHHEIATLLVLLHAPIGANA
FT                   KPELPALQEAGLVEMVKLDPDTAPSFRLTEDGTAVLKGLGYR"
FT                   /protein_id="YP_622930.1"
FT   gene            complement(82682..84574)
FT                   /db_xref="GeneID:4096058"
FT                   /locus_tag="Bcen_3062"
FT   CDS_pept        complement(82682..84574)
FT                   /locus_tag="Bcen_3062"
FT                   /gene_family="HOG000219006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B0343
FT                   4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="GI:107025420"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="GeneID:4096058"
FT                   /translation="MQRSIATVSLSGTLAEKLAAVQAAGFDGVEIFENDLVYFDGSPAD
FT                   VRRMAADLGLDIVLFQPFRDFEGVSPAQLARNLDRIKRKFDVMHALGTDRILVCSSVAA
FT                   DTIADDGLLVDQLGVLAEAARQAGVVAAYEALAWGRVVKRYGHAWKLVNAVNSPHLGLA
FT                   LDSFHTLSLDDSPDGIADIPGDRIAFVQIADAPKLVMDVLEWSRHYRSFPGQGDFDLAR
FT                   FTARVIESGYTGPLSLEIFNDGFRAAPTALTAADGHRSLLYLEDLTRARLAQEGRAPAA
FT                   SQPLFAPPAPPAHVGFQFIEFAVDAQAAATVGEWLGRMRFRLAGRHRSKDVTLFQHGAA
FT                   SIVLNAERDSFADAFFQQHGLSLCASAFRVDDANVAFERAAGFGYAPFSGRVGPNERVL
FT                   PSVKAPDGSLEYFVDEAPDTPTLYESDFVLTDIDGPTEVGPLTGIDHVCLALPADALDT
FT                   WILFFKTAFGFEAERSWLVPDPYGLMRSRAVRSADGSVRIALNASVDRHTAVAESLDRY
FT                   HGTGLNHVAFRTDDIVKTVAAFAADGVPFLRIPANYYDDLAARYALPDELIDTLSAHHL
FT                   LYDRDEHGGEFLHAYTELVDNRFSLEIVERRGGYDGYGAANAAVRLAAQAQRRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_622931.1"
FT   misc_feature    complement(83846..84574)
FT                   /note="Sugar phosphate isomerases/epimerases [Carbohydrate
FT                   transport and metabolism]; Region: IolE; COG1082"
FT                   /db_xref="CDD:31279"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(82754..83689)
FT                   /note="4-hydroxyphenylpyruvate dioxygenase; Region: 4HPPD;
FT                   TIGR01263"
FT                   /db_xref="CDD:162275"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(83288..83686)
FT                   /note="N-terminal domain of 4-hydroxyphenylpyruvate
FT                   dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS);
FT                   Region: HPPD_N_like; cd08342"
FT                   /db_xref="CDD:176690"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(order(83492..83494,83576..83578,83582..83584,
FT                   83642..83647,83651..83659))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176690"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(82754..83254)
FT                   /note="C-terminal domain of 4-hydroxyphenylpyruvate
FT                   dioxygenase (HppD) and hydroxymandelate Synthase (HmaS);
FT                   Region: HPPD_C_like; cd07250"
FT                   /db_xref="CDD:176673"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(order(82769..82771,82802..82804,83003..83005,
FT                   83048..83050,83072..83074,83078..83080,83117..83119,
FT                   83237..83239))
FT                   /note="active site"
FT                   /db_xref="CDD:176673"
FT                   /locus_tag="Bcen_3062"
FT   misc_feature    complement(order(82769..82771,83003..83005,83237..83239))
FT                   /note="Fe binding site; other site"
FT                   /db_xref="CDD:176673"
FT                   /locus_tag="Bcen_3062"
FT   gene            84832..85287
FT                   /db_xref="GeneID:4096059"
FT                   /locus_tag="Bcen_3063"
FT   CDS_pept        84832..85287
FT                   /locus_tag="Bcen_3063"
FT                   /gene_family="HOG000217278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="catalyzes the formation of 3-dehydroshikimate from
FT                   3-dehydroquinate in chorismate biosynthesis"
FT                   /db_xref="GI:107025421"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="GeneID:4096059"
FT                   /translation="MSKHKVLVLNGPNLNLLGTREPHIYGAETLADLEQRCRTAAEGLG
FT                   LEIEFRQSNAEHQLIDWLHAARHDTHGIVINPAAYTHTSVALADALSAIAKPVIEVHIS
FT                   NVHRREAFRHHSYISAIAEAVICGCGTEGYVFALQRLATLFAQGAAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_622932.1"
FT   misc_feature    84886..85263
FT                   /note="Dehydroquinase (DHQase), type II. Dehydroquinase (or
FT                   3-dehydroquinate dehydratase) catalyzes the reversible
FT                   dehydration of 3-dehydroquinate to form 3-dehydroshikimate.
FT                   This reaction is part of two metabolic pathways: the
FT                   biosynthetic shikimate pathway...; Region: DHQase_II;
FT                   cd00466"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="Bcen_3063"
FT   misc_feature    order(84889..84891,84904..84906,85057..85059,85063..85068,
FT                   85075..85077,85096..85098,85135..85143,85168..85170)
FT                   /note="active site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="Bcen_3063"
FT   misc_feature    order(84991..85005,85012..85014,85021..85023,85066..85068,
FT                   85087..85089,85096..85101,85108..85110,85168..85170)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="Bcen_3063"
FT   misc_feature    order(85144..85146,85150..85155,85186..85191,85195..85206,
FT                   85210..85218,85225..85227,85237..85239,85249..85251,
FT                   85258..85260)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="Bcen_3063"
FT   gene            85284..86138
FT                   /db_xref="GeneID:4096060"
FT                   /locus_tag="Bcen_3064"
FT   CDS_pept        85284..86138
FT                   /locus_tag="Bcen_3064"
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="AroE; catalyzes the conversion of shikimate to
FT                   3-dehydroshikimate"
FT                   /db_xref="GI:107025422"
FT                   /db_xref="InterPro:IPR000205"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="GeneID:4096060"
FT                   /translation="MSRPSFLIGLIGQGIGGSLSPAMHEEEGFRQGFGYVYRRIDLDVL
FT                   GVTADALPQLLDAAQRMGYNGLNITHPCKQRVIEHLDALSDDARALGAVNTVLFKDGKR
FT                   IGHNTDWSGFAKSFSRGLPGASLERVVQLGAGGAGAAVAHAALQMGAAELTIFDVDGTR
FT                   ATALAGELQQRFPAARVTPGSDLAAAMRAATGLIHCTPTGMVKHPGLPLPADLLHAGMW
FT                   VADIVYFPLETELIHAARAAGCATLPGGGMAVYQAVDAFELFTGRTPDAERMFSHFQSL
FT                   VAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_622933.1"
FT   misc_feature    85344..86135
FT                   /note="shikimate 5-dehydrogenase; Reviewed; Region:
FT                   PRK12549"
FT                   /db_xref="CDD:171572"
FT                   /locus_tag="Bcen_3064"
FT   misc_feature    85344..85574
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="Bcen_3064"
FT   misc_feature    85608..86081
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_3064"
FT   misc_feature    order(85611..85613,85965..85967,86040..86042,86049..86051)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_3064"
FT   misc_feature    order(85686..85688,85695..85697,85755..85760,85878..85886,
FT                   85959..85961,86028..86030,86037..86042)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_3064"
FT   gene            86172..87515
FT                   /db_xref="GeneID:4096061"
FT                   /locus_tag="Bcen_3065"
FT   CDS_pept        86172..87515
FT                   /locus_tag="Bcen_3065"
FT                   /gene_family="HOG000113642" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0346 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107025423"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096061"
FT                   /translation="MQHTTHTSAAPAQAAGTVRRTSARYKILALLAIGTMINYLDRTVL
FT                   GVAAPQLTKELGINAAVMGIMFSAFSWTYVAMQVPGGLFLDRFGSKVTYYWSMTLWSLC
FT                   TFLQGFVPGVATLLACRLGLGVTEAPCFPTNSRVVATWFPQNERAMATGTYTVGEYIGL
FT                   AFFSPVLFALMGAFGWRSLFWVVGAVGIAFGLIWWKFYHEPRNHPGANAEELAYIEAGG
FT                   GLVHGARKSGDKGDKPAQAQFSWSMVGQLVKKRQLAGICLGQFAGNSTLVFFLTWFPTY
FT                   LATERHMGWLKIGFFAVMPFIAASVGVMFGGIFSDWLLRRGKSANLARKLPIIAGLLLA
FT                   STIILANYVQSNEAVIAIMSVAFFAQGMAALGWTLVSDIAPDGLLGVTGGIFNFAANLA
FT                   GIITPLVVGFIVASTGSFVGALVFIGVIALVGALSYIFVVGDIKRIEL"
FT                   /protein_id="YP_622934.1"
FT   misc_feature    86253..87485
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3065"
FT   misc_feature    86268..87488
FT                   /note="d-galactonate transporter; Region: 2A0114;
FT                   TIGR00893"
FT                   /db_xref="CDD:162094"
FT                   /locus_tag="Bcen_3065"
FT   misc_feature    order(86295..86297,86304..86312,86316..86321,86370..86372,
FT                   86379..86384,86391..86393,86403..86408,86412..86417,
FT                   86553..86558,86565..86570,86577..86582,86589..86591,
FT                   86625..86630,86637..86642,86658..86660,86973..86975,
FT                   86982..86987,86994..86999,87006..87008,87048..87050,
FT                   87060..87062,87072..87074,87081..87083,87093..87095,
FT                   87255..87257,87264..87269,87276..87278,87288..87293,
FT                   87300..87302,87333..87338,87345..87350,87357..87362,
FT                   87369..87371)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3065"
FT   gene            complement(87619..88728)
FT                   /db_xref="GeneID:4096062"
FT                   /locus_tag="Bcen_3066"
FT   CDS_pept        complement(87619..88728)
FT                   /locus_tag="Bcen_3066"
FT                   /gene_family="HOG000171816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of phosphonoacetaldehyde
FT                   from 2-aminoethylphosphonate and pyruvate"
FT                   /db_xref="GI:107025424"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="GeneID:4096062"
FT                   /translation="MPAPILLTPGPLTTSATTRHAMQHDWGSWDAAFNQLTASVCADLV
FT                   AIAHGGDEYVCVPMQGSGTFSVEAALGTLVPRDGVVLVPDNGAYCARILKILGRLGIDA
FT                   IALPFGEDAAVDAAAVEAAFAREPRITHVALVHLETSAGILNPLDAIAAACRRHGKRLI
FT                   VDAMSSFGALPIALADSGIDALISASGKCLEGVPGMGFAIVRRDALDASEGNSPSLALD
FT                   LHDQYAYLRKTGQWRFTPPTHVIAALRAALDQYLAEGGQPARGARYADNCRTLVESMRA
FT                   LGFVPFLDASVQAPVIVTFHAPDHPAYDFRRFYDAVRGAGFILYPGKLTRLETFRVGCI
FT                   GAIDAGDIRRAVAAIGAAVESLGIAMQPA"
FT                   /protein_id="YP_622935.1"
FT   misc_feature    complement(87814..88716)
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Bcen_3066"
FT   misc_feature    complement(order(88156..88158,88165..88167,88225..88227,
FT                   88234..88236,88321..88323,88528..88530,88537..88542))
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen_3066"
FT   misc_feature    complement(88156..88158)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen_3066"
FT   gene            88989..90080
FT                   /db_xref="GeneID:4096121"
FT                   /locus_tag="Bcen_3067"
FT   CDS_pept        88989..90080
FT                   /locus_tag="Bcen_3067"
FT                   /gene_family="HOG000218985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter periplasmic-binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ABC transporter periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: bur:Bcep18194_B0348 thiamine ABC
FT                   transporter periplasmic binding protein"
FT                   /db_xref="GI:107025425"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:4096121"
FT                   /translation="MTLQKPSRAAAGAFRKLALAACAAGLLQGAAMPAHAANAVVLYTA
FT                   DGLENLYRDVLPAFEKKEGVKVNIVTAGSGEVVNRANIEKNSPKADVIVTLPPFIQQAG
FT                   QMGLLQPYQSVNYKNVPAIAKAEDGTWATFVNNYFSFAINPDVVKNQPKTFADLLSPSY
FT                   AGKVAYSNPATAGDGMAVLILTTSLMGEDKAFDYLAKLSQSVKFHTKGTGYLNVLLSRN
FT                   EISVANGDLQMDLDDAEHGALSVKPIFLAAKAGDQPTTFQLPYGIGLIKSGPNQDAGRK
FT                   LIDYLMSTEVQSKVPDMYGIPGRTDVPLAGKNGEAVKKAIAGVKLIPVDWTQVMAKKPE
FT                   WIERWKKDVIGSSGKQLDVVKPK"
FT                   /protein_id="YP_622936.1"
FT   sig_peptide     88989..89099
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 37"
FT                   /locus_tag="Bcen_3067"
FT                   /product="hypothetical protein"
FT   misc_feature    89151..90035
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_3067"
FT   gene            90115..91218
FT                   /db_xref="GeneID:4096122"
FT                   /locus_tag="Bcen_3068"
FT   CDS_pept        90115..91218
FT                   /locus_tag="Bcen_3068"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0349 ABC transporter, ATPase subunit"
FT                   /db_xref="GI:107025426"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="GeneID:4096122"
FT                   /translation="MNPVDTTLTHPGAFGAAEPHATLRSGAPGGVQIEHLSVRYGARTV
FT                   LEDLSLSIGAGEFLTVLGKSGCGKTTLLRFIAGFVKADGLTGTLTVAGRDLTHAPPHKR
FT                   NLGLLFQNYALFPHLSVFENVAFGLRARGMASSEVTRRVADALKLVQLGDAGHHLPAQL
FT                   SGGMQQRVALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTH
FT                   DRDDALVLSDRALLMRDGHIAQLGTPQQLYDAPRDGYVARYLGPANLLPPHVIFPLGDP
FT                   RHEVRGKVACVRPERLTVMPPAAGGLHGTVSSVEWQGADLSIAVVIDAAPDEPVRVTMQ
FT                   RGRGVAPERGARVSLHCEADDVVLIEP"
FT                   /protein_id="YP_622937.1"
FT   misc_feature    90190..91215
FT                   /note="2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding component PhnT; Region: PhnT; TIGR03258"
FT                   /db_xref="CDD:132302"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90205..90909
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90301..90324
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    order(90310..90315,90319..90327,90445..90447,90673..90678,
FT                   90778..90780)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90436..90447
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90601..90630
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90661..90678
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90685..90696
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90766..90786
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcen_3068"
FT   misc_feature    90982..91209
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Bcen_3068"
FT   gene            91238..92116
FT                   /db_xref="GeneID:4096123"
FT                   /locus_tag="Bcen_3069"
FT   CDS_pept        91238..92116
FT                   /locus_tag="Bcen_3069"
FT                   /gene_family="HOG000218974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0350 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:107025427"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4096123"
FT                   /translation="MLASAAAHAAAARRRRRIGDLHLAALAIVVLGPLVVYPLVRLVLL
FT                   SVTGDHGLSFAAYRTFFGNPDTRNVLLTTLGVLFASAGTASVLGVLLAALLFFRPFPGA
FT                   SLVTRFLELYVAFPSFLVAFTLIFLYGSQGSISIALQHLFHLENPPLDFLFGIGGVILA
FT                   QTVFYTPFVVRPTLASFATLDLRLIEAARSLGAPGWMLARRVVLPIAWPGIAAGTVLCF
FT                   LLTLNEFGILLVLGSARLVTLPVAIYSSATVDLDLPTASAGAVVMLSLSLALYAVYRRV
FT                   NRRATGGNDVR"
FT                   /protein_id="YP_622938.1"
FT   misc_feature    91532..92053
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3069"
FT   misc_feature    order(91556..91567,91571..91600,91607..91612,91616..91618,
FT                   91733..91738,91742..91744,91748..91750,91757..91762,
FT                   91766..91768,91778..91783,91790..91792,91841..91843,
FT                   91883..91888,91895..91897,91916..91927,91934..91939,
FT                   91976..91981,92003..92008,92015..92020,92024..92029,
FT                   92036..92041,92048..92053)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3069"
FT   misc_feature    order(91574..91618,91916..91933)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3069"
FT   misc_feature    order(91616..91618,91715..91717,91934..91936,91970..91972,
FT                   91979..91981,92003..92005)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3069"
FT   misc_feature    order(91793..91831,91847..91852,91862..91864)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcen_3069"
FT   gene            92106..92966
FT                   /db_xref="GeneID:4096124"
FT                   /locus_tag="Bcen_3070"
FT   CDS_pept        92106..92966
FT                   /locus_tag="Bcen_3070"
FT                   /gene_family="HOG000218963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0351 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:107025428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4096124"
FT                   /translation="MSAEFRIGQAVPRHPLGWTDALLKHASRAALALAAFACFWLFVLP
FT                   VVVVALSSVSTQWSGTILPAGYSLRWFERLGSPEYDALLTSLEIGFGVSALGTILGLWL
FT                   ALALEGRDRRGLGALVDALVMVPNGVPSVVLGLAVLIAYHQKPLDLSSSAAIVVLVQLA
FT                   LILPFCYRCAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPALRASLALGFALS
FT                   LGELGATLTVYPPGFATVPIVVIGQVERGYYLPASALSLLMLGASLAALLLIAARVPRG
FT                   KRAAS"
FT                   /protein_id="YP_622939.1"
FT   misc_feature    92274..92864
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Bcen_3070"
FT   gene            92963..94273
FT                   /db_xref="GeneID:4096125"
FT                   /locus_tag="Bcen_3071"
FT   CDS_pept        92963..94273
FT                   /locus_tag="Bcen_3071"
FT                   /gene_family="HOG000218962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphonoacetate hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Phosphonoacetate hydrolase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; KEGG:
FT                   bur:Bcep18194_B0352 type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="GI:107025429"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="GeneID:4096125"
FT                   /translation="MNAAFALRLPGEQPAAGKGSSDLAGRSIDVNGRRYRLPVDPTVVI
FT                   CVDGCEYDYLECAVEAGVAPFIGRTIAEGTAWRADCVVPTFTNPNNLSIVCGVPPSVHG
FT                   ICGNYFWDPAADGGRGAEVMMNDPAYLRAGTLLAAASDAGARVAVVTAKDKLRRLLGWQ
FT                   LNGICFSAEKAAQANLAENGIVDVLDWVGLPSPDVYSAALSEFVFAAGVRLAQTRQVDL
FT                   MYLSTTDYVQHKCEPGSAGANAFYAMMDGYLAQLDALGWAIGLTADHGMNAKHDPATGR
FT                   PNVIYLQDAFDGWYGTQAARVILPITDPYVVHHGALGSFATIYLAPGVDRAEAMWRVGG
FT                   LDGVELVLDNAEAAARFELPADRIGDLVVIGRRDMTLGTREREHDLSGLTVPLRSHGGV
FT                   SEQEVPLLFNRRIERDDPARRPRNFDVFDFVLNRIAT"
FT                   /protein_id="YP_622940.1"
FT   misc_feature    93044..94267
FT                   /note="Sulfatase; Region: Sulfatase; cl10460"
FT                   /db_xref="CDD:175217"
FT                   /locus_tag="Bcen_3071"
FT   gene            94273..95724
FT                   /db_xref="GeneID:4096126"
FT                   /locus_tag="Bcen_3072"
FT   CDS_pept        94273..95724
FT                   /locus_tag="Bcen_3072"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0353 aldehyde dehydrogenase"
FT                   /db_xref="GI:107025430"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4096126"
FT                   /translation="MAHPRQDHPSFRAEALRWCGTHAMRERTLDVTDPYTGTRVGTAPL
FT                   ASVDDVRAAFDYAMAYRPTLTRYARSQILERAAALLRERTEEASDLITLESGLSKQDSR
FT                   YEIGRVADVLKFAAAEALRDDAQSFSCDLTPHGKARRVFSQRQPLDGVIVAITPFNHPM
FT                   NQVAHKIAPAIATNNRVIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGNPAEIADE
FT                   LVTHPHASLITFTGGVAIGKAIAARAGYRRIVLELGGNDPLIVLADADLDRAASLAVLG
FT                   SYRNSGQRCTAVKRMLVQRSIAPAFTELLVEKTRAWKYGDPFDPANEMGTVIDETAARL
FT                   FEVRVNEAVAQGARLLTGNVRRGALYAPTVLDNVDPSMTIVREETFGPVSPVIAFDTIE
FT                   DAIRISNGTAFGLSSGVCTDSTAAVVRFVNELKVGTVNVWEVPGYRIELSPFGGIKDSG
FT                   LGYKEGVQEAMKSFTNLKTFSLPWE"
FT                   /protein_id="YP_622941.1"
FT   misc_feature    94327..95709
FT                   /note="1-pyrroline-5-carboxylate dehydrogenase;
FT                   Provisional; Region: PRK03137"
FT                   /db_xref="CDD:167499"
FT                   /locus_tag="Bcen_3072"
FT   misc_feature    94357..95712
FT                   /note="Streptomyces putative phosphonoformaldehyde
FT                   dehydrogenase PhpJ-like; Region: ALDH_PhpJ; cd07146"
FT                   /db_xref="CDD:143464"
FT                   /locus_tag="Bcen_3072"
FT   misc_feature    order(94738..94752,94774..94776,94819..94821,94825..94830,
FT                   94972..94983,94990..94992,94999..95004,95038..95046,
FT                   95140..95142,95422..95424,95428..95430,95506..95508,
FT                   95623..95625)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143464"
FT                   /locus_tag="Bcen_3072"
FT   misc_feature    order(94750..94752,95038..95040,95131..95133,95140..95142)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143464"
FT                   /locus_tag="Bcen_3072"
FT   gene            95729..96283
FT                   /db_xref="GeneID:4096127"
FT                   /locus_tag="Bcen_3073"
FT   CDS_pept        95729..96283
FT                   /locus_tag="Bcen_3073"
FT                   /gene_family="HOG000218951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HD phosphohydrolase-like"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0354 HD phosphohydrolase-like"
FT                   /db_xref="GI:107025431"
FT                   /db_xref="GeneID:4096127"
FT                   /translation="MALTVEEIHGLYREHGHVAYSGEPVTQLEHALQSGLLAEESGVDE
FT                   ALVAAAFLHDLGHLLNRQGDTPSARGIDDLHQYYVLPFLRPLFSDAVLEPIRLHVDAKR
FT                   CLCRTDAGYFESLSPDSVRSLALQGGVFSEEETAAFLRRPFAEDALRLRRWDDTAKEEG
FT                   KATPDLDHYMEIVARQVRARS"
FT                   /protein_id="YP_622942.1"
FT   misc_feature    95732..96268
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Bcen_3073"
FT   gene            96796..98321
FT                   /db_xref="GeneID:4096128"
FT                   /locus_tag="Bcen_R0071"
FT   rRNA            96796..98321
FT                   /db_xref="GeneID:4096128"
FT                   /locus_tag="Bcen_R0071"
FT                   /product="16S ribosomal RNA"
FT   gene            98385..98461
FT                   /note="tRNA-Ile1"
FT                   /db_xref="GeneID:4096129"
FT                   /locus_tag="Bcen_R0072"
FT   tRNA            98385..98461
FT                   /db_xref="GeneID:4096129"
FT                   /locus_tag="Bcen_R0072"
FT                   /product="tRNA-Ile"
FT   gene            98500..98575
FT                   /note="tRNA-Ala3"
FT                   /db_xref="GeneID:4096130"
FT                   /locus_tag="Bcen_R0073"
FT   tRNA            98500..98575
FT                   /db_xref="GeneID:4096130"
FT                   /locus_tag="Bcen_R0073"
FT                   /product="tRNA-Ala"
FT   gene            98852..101732
FT                   /db_xref="GeneID:4096131"
FT                   /locus_tag="Bcen_R0074"
FT   rRNA            98852..101732
FT                   /db_xref="GeneID:4096131"
FT                   /locus_tag="Bcen_R0074"
FT                   /product="23S ribosomal RNA"
FT   gene            101887..101999
FT                   /db_xref="GeneID:4096132"
FT                   /locus_tag="Bcen_R0075"
FT   rRNA            101887..101999
FT                   /db_xref="GeneID:4096132"
FT                   /locus_tag="Bcen_R0075"
FT                   /product="5S ribosomal RNA"
FT   gene            102612..104036
FT                   /db_xref="GeneID:4096133"
FT                   /locus_tag="Bcen_3074"
FT   CDS_pept        102612..104036
FT                   /locus_tag="Bcen_3074"
FT                   /gene_family="HOG000193485" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0355 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107025432"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096133"
FT                   /translation="MTDSPAQSGRTTDFLPYLVAATFFMEYLDTTVIATALPQMAHSFG
FT                   VGPNALSLGMTAYMLALAVFIPISGWIADRYGSRTVFASAIVVFTGASVLCGLSEGVMS
FT                   FTAARLLQGVGGAMMVPVGRMIVVRSTEKAKLMRAIATITWPGIVAPVVGPPIGGFITT
FT                   YASWRWIFLLNVPFGLAALVCTWLIVRNTRADEQRPLDWVGFVLAGGALTCLLIGTEAA
FT                   GQQDVDFTRAGVLVGASVLFGIAAWLYARRCAHPLLDFTTLKVPTFSVTVITGSITRMA
FT                   INAVPYLLPLLFQIGFGLSPFQSGLLLLASALGNLGMKAGTSWILDRYGFRRVALVDVT
FT                   IVGIFMIACGWLTASTPLAITLLLVFVYGLTRSMQFTTLATLAYADIPSHQTSAASTLW
FT                   SAAQQMTIGMGIAFGALSLRLAALVRGDAAGMHYVLADFRWAFIAAGVLALLTLPGYAR
FT                   LASDAGDRLRANMARG"
FT                   /protein_id="YP_622943.1"
FT   misc_feature    102612..104003
FT                   /note="multidrug efflux system protein MdtE; Provisional;
FT                   Region: PRK10504"
FT                   /db_xref="CDD:170483"
FT                   /locus_tag="Bcen_3074"
FT   misc_feature    102660..>103187
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3074"
FT   misc_feature    order(102699..102701,102708..102716,102720..102725,
FT                   102774..102776,102783..102788,102795..102797,
FT                   102807..102812,102816..102821,102957..102962,
FT                   102969..102974,102981..102986,102993..102995,
FT                   103029..103034,103041..103046,103062..103064)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3074"
FT   gene            complement(104290..105051)
FT                   /db_xref="GeneID:4096134"
FT                   /locus_tag="Bcen_3075"
FT   CDS_pept        complement(104290..105051)
FT                   /locus_tag="Bcen_3075"
FT                   /gene_family="HOG000218940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0356 hypothetical protein"
FT                   /db_xref="GI:107025433"
FT                   /db_xref="GeneID:4096134"
FT                   /translation="MPRGTPVNIVDLQPAVESLDIAQRVDALDWPSVDAELDRFGCARV
FT                   PGLMSASECDALASLYPRDALYRSRVVMARHGFGRGEYKYFAYPLPAIIAELRATMYPH
FT                   LAPIANRWNQALGIDVRYPKDHATFLDRCHAAGQTRPTPLILQYGADDYNCLHQDLYGE
FT                   HVFPLQVAILLSAPGRDFTGGEFVLTEQRPRMQSRAEVVPLTQGDAVIFAVHGRPVQGT
FT                   RGIYRVNLRHGVSRIRSGHRYTVGIIFHDAQ"
FT                   /protein_id="YP_622944.1"
FT   misc_feature    complement(104296..104814)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2086); Region: DUF2086; cl01578"
FT                   /db_xref="CDD:154483"
FT                   /locus_tag="Bcen_3075"
FT   gene            complement(105370..106962)
FT                   /db_xref="GeneID:4096135"
FT                   /locus_tag="Bcen_3076"
FT   CDS_pept        complement(105370..106962)
FT                   /locus_tag="Bcen_3076"
FT                   /gene_family="HOG000231893" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate transporter; KEGG:
FT                   bur:Bcep18194_B0357 phosphate transporter"
FT                   /db_xref="GI:107025434"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="GeneID:4096135"
FT                   /translation="MNQPASSAPNNPGSVARTRQVGYAAFLLVLVLGAVYIATHLVADL
FT                   APVREGTLFPYLLLGAALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWN
FT                   FLGVMVSSGAVAFGILQLLPVELILQVGSGSGFAMVFALLIAAIVWNLATWYFGLPSSS
FT                   SHTLIGSIIGVGLMNQLMHGPSGTSGVDWGQALGVGKSLLLSPIVGFLCASLLLLALKA
FT                   LVRIPELYKEPPKDQPPPFWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTA
FT                   YALNKAVTPTESQTFVAVANQAAATFGKYTNGVAPSANPRADVEHYVQHRELTPAVLPA
FT                   VAQLSTSLATAVGASGSMAAVPQRDVDNVRNTMYLVSEAIRLMEKSGQPAFATDDKLAI
FT                   DNYRKQLDHATKFIPTWVKVAVAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAE
FT                   LVAMLTIGAADMYGLPVSTTHVLSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIA
FT                   LAAGLYWLFRSLA"
FT                   /protein_id="YP_622945.1"
FT   misc_feature    complement(<106114..106746)
FT                   /note="Phosphate transporter family; Region: PHO4; cl00396"
FT                   /db_xref="CDD:153743"
FT                   /locus_tag="Bcen_3076"
FT   misc_feature    complement(105376..>105735)
FT                   /note="Phosphate transporter family; Region: PHO4; cl00396"
FT                   /db_xref="CDD:153743"
FT                   /locus_tag="Bcen_3076"
FT   gene            complement(107127..107717)
FT                   /db_xref="GeneID:4095986"
FT                   /locus_tag="Bcen_3077"
FT   CDS_pept        complement(107127..107717)
FT                   /locus_tag="Bcen_3077"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   bur:Bcep18194_B0358 phosphoglycerate/bisphosphoglycerate
FT                   mutase"
FT                   /db_xref="GI:107025435"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:4095986"
FT                   /translation="MNLHASLRLIAHASTRAMRTGTFPDDDPLDAHGLAEAAALRGRWT
FT                   AAAGSLVLCSPARCARQTADALGLHADIDDALRDIDYGHWRGKRLHDLARDLPDELAAW
FT                   LGTPSASPHHGESFDAAAHRIGTWLNVLPPDRDVIAITHAPIVRAAIAHMLRIAPEAAA
FT                   RLDVAPLSCTTFVASPAGWTLATTDDDPRDTGA"
FT                   /protein_id="YP_622946.1"
FT   misc_feature    complement(107268..107693)
FT                   /note="Histidine phosphatase domain found in a functionally
FT                   diverse set of proteins, mostly phosphatases; contains a
FT                   His residue which is phosphorylated during the reaction;
FT                   Region: HP; cl11399"
FT                   /db_xref="CDD:175238"
FT                   /locus_tag="Bcen_3077"
FT   gene            107940..108149
FT                   /db_xref="GeneID:4095987"
FT                   /locus_tag="Bcen_3078"
FT   CDS_pept        107940..108149
FT                   /locus_tag="Bcen_3078"
FT                   /gene_family="HOG000218929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0359 hypothetical protein"
FT                   /db_xref="GI:107025436"
FT                   /db_xref="GeneID:4095987"
FT                   /translation="MSEAVLKPAVVPAPIPVRELLPWAVFVGLILLLALYFVGAEQGAT
FT                   SLVPGMLVHEFVHDGRHLLGFPCH"
FT                   /protein_id="YP_622947.1"
FT   gene            108163..108885
FT                   /db_xref="GeneID:4095988"
FT                   /locus_tag="Bcen_3079"
FT   CDS_pept        108163..108885
FT                   /locus_tag="Bcen_3079"
FT                   /gene_family="HOG000218917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0360 hypothetical protein"
FT                   /db_xref="GI:107025437"
FT                   /db_xref="GeneID:4095988"
FT                   /translation="MVGKLLMRGMLAGIAAGLLTFGFARIVGEPQVDQAIAFEEKTTAA
FT                   QGEAPEPELVSRHTQAGLGLLTGVVTYGAAFGGLFSLVFAYAYGRGSRLPARPLAAWLA
FT                   LAAFVALVIVPNLKYPANPPSVGDPDTIGYRTGLFFLMIAISVATMVFAVGVRRHLLAK
FT                   LGQWNASIVAGLVFVAIIAAVQVGLPSVSELPADFPAALLWKFRVAAIGMQVIMWTTIG
FT                   LLFGAWVERGERAGMRAA"
FT                   /protein_id="YP_622948.1"
FT   misc_feature    108163..108855
FT                   /note="Probable cobalt transporter subunit (CbtA); Region:
FT                   CbtA; cl02266"
FT                   /db_xref="CDD:164015"
FT                   /locus_tag="Bcen_3079"
FT   sig_peptide     108163..108246
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.826) with cleavage site probability 0.383 at
FT                   residue 28"
FT                   /locus_tag="Bcen_3079"
FT                   /product="hypothetical protein"
FT   gene            complement(108909..109817)
FT                   /db_xref="GeneID:4095989"
FT                   /locus_tag="Bcen_3080"
FT   CDS_pept        complement(108909..109817)
FT                   /locus_tag="Bcen_3080"
FT                   /gene_family="HOG000218906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0361 transcriptional regulator, LysR family"
FT                   /db_xref="GI:107025438"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095989"
FT                   /translation="MLERFHLVVIREVERQGSLTAAANALHLTQSALSHTVRKIEQQLG
FT                   TPIWDREGRGLRLTQGGQYLLKLANRLLPQFELAEERMKQYAKGERGTLRIGMECHPCY
FT                   QWLLKVVSPYLSRWPDVDVDVKQRFQFGGIGALFGYDIDVLVTPDPLNKPGLRFDPVFD
FT                   YEQVLVVADSHRFANVDHVTPEQLTDEVLITYPVETDRLDIYNQFLSPAGIVPRRHKSI
FT                   ETTDIMLQMVASGRGVAALPRWLADEYADRMPVVPVKLGKKGIAKQIFLGIREADAAID
FT                   YLAAFVALARESTWSAPRMLR"
FT                   /protein_id="YP_622949.1"
FT   misc_feature    complement(108942..109802)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_3080"
FT   misc_feature    complement(109629..109802)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3080"
FT   misc_feature    complement(108948..109541)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator metR, which regulates the
FT                   expression of methionine biosynthetic genes, contains type
FT                   2 periplasmic binding fold; Region: PBP2_MetR; cd08441"
FT                   /db_xref="CDD:176132"
FT                   /locus_tag="Bcen_3080"
FT   misc_feature    complement(order(109116..109121,109125..109130,
FT                   109146..109163,109437..109457,109461..109463,
FT                   109473..109475,109482..109487,109491..109496))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176132"
FT                   /locus_tag="Bcen_3080"
FT   gene            109945..112239
FT                   /db_xref="GeneID:4095990"
FT                   /locus_tag="Bcen_3081"
FT   CDS_pept        109945..112239
FT                   /locus_tag="Bcen_3081"
FT                   /gene_family="HOG000246221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-methyltetrahydropteroyltriglutamate--
FT                   homocysteine S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="catalyzes the transfer of a methyl group from
FT                   5-methyltetrahydrofolate to homocysteine to form
FT                   methionine"
FT                   /db_xref="GI:107025439"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="GeneID:4095990"
FT                   /translation="MVTTHNLGFPRIGAKRELKFGLERYWKGESSRDELKALGAELRRR
FT                   HWHDQRDLDLAPLGDFAFYDQVLDMSFTLGNLPKRVQDFHGDALDNYFRVARGRSAQSA
FT                   EEHAACCGGVAAGEMTKWFDTNYHYIVPEFHADTNFSLDPSRLLQQLAEANAQGVNAKP
FT                   VILGPVTYLWLGKAKDVSDRLALLPKLLPVYGALLDTLTAQGVEWVQIDEPILVTELDA
FT                   EWRQAFRTAYAALETRRIKLLLATYFGQLQDNLTLAASLPVDGLHIDAINARDEVDALV
FT                   RELPAERVLSVGAINGRNIWKTDLNAALDWLEPLAKQLGDRLWLAPSCSLLHVPVDLAS
FT                   EEKLDAEIRSWLAFALQKLDELKVLATALNEGRDKVADALAANAAAIDSRRRSPRVNNP
FT                   VVKAAIARIDAQLGNRASPYTQRASKQSARLNLPAFPTTTIGSFPQTAEIRQARSRFRA
FT                   GALDEAGYRTAMRAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGYAFSQFGW
FT                   VQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDD
FT                   QPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFR
FT                   ITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAFDTFKYPNE
FT                   IGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMV
FT                   AAAKTLRNQVQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_622950.1"
FT   misc_feature    109945..112236
FT                   /note="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; Provisional; Region: PRK05222"
FT                   /db_xref="CDD:167931"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    109951..111048
FT                   /note="N-terminal domain_like. Many members have been
FT                   characterized as
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferases, EC:2.1.1.14, mostly from bacteria and
FT                   plants. This enzyme catalyses the last step in the
FT                   production of methionine by...; Region:
FT                   CIMS_N_terminal_like; cd03312"
FT                   /db_xref="CDD:48147"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    order(109990..109992,109999..110001,110305..110307,
FT                   110320..110322,110326..110328)
FT                   /note="THF binding site; other site"
FT                   /db_xref="CDD:48147"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    111250..112215
FT                   /note="C-terminal domain_like. Many members have been
FT                   characterized as
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferases, EC:2.1.1.14, mostly from bacteria and
FT                   plants. This enzyme catalyses the last step in the
FT                   production of methionine by...; Region:
FT                   CIMS_C_terminal_like; cd03311"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    order(111262..111270,111421..111423,111439..111441,
FT                   111760..111762,111766..111768,111892..111894,
FT                   111898..111900,112147..112152)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    order(111514..111522,111652..111654,111772..111774)
FT                   /note="THF binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Bcen_3081"
FT   misc_feature    order(111892..111894,111898..111900,111964..111966,
FT                   112147..112149)
FT                   /note="zinc-binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Bcen_3081"
FT   gene            complement(112368..113693)
FT                   /db_xref="GeneID:4095991"
FT                   /locus_tag="Bcen_3082"
FT   CDS_pept        complement(112368..113693)
FT                   /locus_tag="Bcen_3082"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0365 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107025440"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4095991"
FT                   /translation="MGTSVKQPKRAALASFVGTTIEWYDFYSYATAAAIVFGPLFFPGE
FT                   NRFISLLASFGSFAVGFFARPLGGVMFGYLGDRFGRKRSLLATLMLMAVSTVAIGLLPT
FT                   HAQAGVIAPILLVLMRVLQGIAVGGEWGGAVLLAGEHAPEGKRTFFASFAQLGSASGLI
FT                   LSMLAFGAVSTLSKDDMMSWGWRVPFLASSVLLIVGFVIRASVSESPEFEEVRKSGNIA
FT                   QKPLREALKVWPLLLLAIGANVYGIAGVYFSNIFMISYATQFLSLDRSMVLHCMTIVAV
FT                   LQFVVQLAAAFLAQRFGTTRVLLITGAWAMIVPFVMLPLVHLGTPVSITVGVGLATLAE
FT                   SGYYSVVAGFVSGIFVARIRYTAISIAYQVCGALAGGLTPLVATIIAQNTAPQWWPLAI
FT                   QYASAAVLSSLCVWLISRRVSIDDAGAPGKTDDALPRGTRTA"
FT                   /protein_id="YP_622951.1"
FT   misc_feature    complement(112470..113642)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="Bcen_3082"
FT   misc_feature    complement(112449..113495)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3082"
FT   misc_feature    complement(order(112566..112568,112575..112580,
FT                   112587..112592,112602..112607,112638..112640,
FT                   112647..112652,112662..112664,112671..112676,
FT                   112683..112685,112833..112835,112845..112847,
FT                   112854..112856,112866..112868,112878..112880,
FT                   112920..112922,112929..112934,112941..112946,
FT                   112953..112955,113208..113210,113226..113231,
FT                   113238..113243,113277..113279,113286..113291,
FT                   113298..113303,113310..113315,113475..113480,
FT                   113484..113489))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_3082"
FT   gene            complement(113749..114813)
FT                   /db_xref="GeneID:4095992"
FT                   /locus_tag="Bcen_3083"
FT   CDS_pept        complement(113749..114813)
FT                   /locus_tag="Bcen_3083"
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="agmatinase, putative"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: agmatinase, putative; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   bur:Bcep18194_B0366 putative agmatinase"
FT                   /db_xref="GI:107025441"
FT                   /db_xref="InterPro:IPR005924"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="GeneID:4095992"
FT                   /translation="MFTSISSHSSFPAERVKLCARPRRMIRQPHIGRDDPMNDHTHFQP
FT                   LGGNEMPRCGGIATMMRLPHVSSAEGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVL
FT                   LRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDH
FT                   TIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQ
FT                   IGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYITFDIDGI
FT                   DPAYAPGTGTPEIAGLTVPQALEIIRGAMGLNIVGCDLVEVAPPYDPFGTTALLGANLA
FT                   YELLCVLPGVAYRD"
FT                   /protein_id="YP_622952.1"
FT   misc_feature    complement(113779..114597)
FT                   /note="Arginase family; Region: Arginase; cl00306"
FT                   /db_xref="CDD:174098"
FT                   /locus_tag="Bcen_3083"
FT   gene            114840..115757
FT                   /db_xref="GeneID:4095993"
FT                   /locus_tag="Bcen_3084"
FT   CDS_pept        114840..115757
FT                   /locus_tag="Bcen_3084"
FT                   /gene_family="HOG000183882" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0367 transcriptional regulator, LysR family"
FT                   /db_xref="GI:107025442"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4095993"
FT                   /translation="MNVLGNLSTLDLRLIRVFLAVTDAGGVSAAQAVLNVGQSTISAQL
FT                   SSLETRLGYRLCERGRSGFRLTPKGERFHAMSRKLLAALDEFGMAARHMDRQLVGTLNI
FT                   GLIGHTPVSQNARIAEAIAAFRTRDEAVRFSISVRAPGDLEEKLLSNEIQIAVGYFWHR
FT                   VPTLHYTPLFIERQIAYCGRGHPLFDGAGTLTPADVAGFEWAWRSYPLPEAQMSTTPDR
FT                   VTATADNMEAVALLILSGHHLGYLPQHFAAPYVAQGLLAPLNPDRLHYEVTFHMVVARD
FT                   GRGDPVVEAFLEDLERAHQSSDVV"
FT                   /protein_id="YP_622953.1"
FT   misc_feature    114867..115745
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_3084"
FT   misc_feature    114873..115052
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3084"
FT   misc_feature    115158..115718
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_3084"
FT   misc_feature    order(115194..115199,115203..115208,115215..115217,
FT                   115227..115229,115233..115253,115509..115526,
FT                   115542..115547,115551..115556)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_3084"
FT   gene            complement(115821..116285)
FT                   /db_xref="GeneID:4095994"
FT                   /locus_tag="Bcen_3085"
FT   CDS_pept        complement(115821..116285)
FT                   /locus_tag="Bcen_3085"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   bur:Bcep18194_B0368 transcriptional regulator, AsnC family"
FT                   /db_xref="GI:107025443"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:4095994"
FT                   /translation="MIDLDKTDRAILAAVQRDGRLPIARLAESVGLSETPCARRLKRLE
FT                   NDGYIERYRAQLSRQALGFGVVAFVLVRFATHDRKVADRFEREVLGIERILACHNVAGT
FT                   ADYLLQVVARDLDDYGTFLRDSLRMLPGVTSIESALSLREVKHDAGLPVP"
FT                   /protein_id="YP_622954.1"
FT   misc_feature    complement(115827..116285)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Bcen_3085"
FT   misc_feature    complement(115947..116276)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_3085"
FT   gene            116420..117040
FT                   /db_xref="GeneID:4095995"
FT                   /locus_tag="Bcen_3086"
FT   CDS_pept        116420..117040
FT                   /locus_tag="Bcen_3086"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine exporter protein LysE/YggA"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0369 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="GI:107025444"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:4095995"
FT                   /translation="MISTHLLLIYLAALAAIYAVPGPDMALVLQTSIGRGVRPGMAAAA
FT                   GLSLARTVHVTLSACGVAALIRSAPWLYEVIRYGGALYLAYVAIQVFRSPVFALGDGDA
FT                   PAGALRQSFVKGLLTNLLNPKALLFCSVLLPQFVRPEVGPVVWQMFELGALLVAAGVCF
FT                   DLACVFGASRIAAWMRAHPLAQTVQRWTFSAALIGFALRLSMD"
FT                   /protein_id="YP_622955.1"
FT   sig_peptide     116420..116500
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.668 at
FT                   residue 27"
FT                   /locus_tag="Bcen_3086"
FT                   /product="hypothetical protein"
FT   misc_feature    116480..117028
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Bcen_3086"
FT   gene            117328..118917
FT                   /db_xref="GeneID:4095996"
FT                   /locus_tag="Bcen_3087"
FT   CDS_pept        117328..118917
FT                   /locus_tag="Bcen_3087"
FT                   /gene_family="HOG000218885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S8/S53 subtilisin kexin sedolisin"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: bur:Bcep18194_B0370 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="GI:107025445"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="GeneID:4095996"
FT                   /translation="MARHLQADREPRIVAESKCLGQCDPAERIHVTIMLRRQEEGQLDA
FT                   LVHQLATGDARAKPVSRDAFAQRFSANPDDIRKTEDFAHRHQLTVDRVDPVESVVVLSG
FT                   TIAQFEAAFSVKLERFEHRSIGQYRGRSGPIVLPDDIGDAVTAVLGLDSRPQARPHFRF
FT                   RPPFKPARGAAAVTFTPIQLASLYDFPAGDGAGQCIAIIELGGGYRAADIQQYFRGLGI
FT                   TTPPKLVDVNVGTGRNAPTGEPNGPDGEVALDIEIAGAIAPAAKIAVYFAPNSDAGFIQ
FT                   AVNAAVTDKTNQPSVISISWGGPEAIWQAQSAQAFNRVLQAAAAQGITVCAASGDSGSG
FT                   DGLQDGADHVDFPASSSYVLGCGGTQLDALPGQGIRSEVTWNDEASGGGAGGGGVSALF
FT                   DLPAWQQGLKVARADGSTTPLAKRGVPDVAGDASPQTGYEVSVAGTPAVMGGTSAVAPL
FT                   WAALIARINAANGASAGWINPVLYKHPGALRDITKGSNGTYAAASGWDACTGLGSPNGA
FT                   QLATILARKPSS"
FT                   /protein_id="YP_622956.1"
FT   misc_feature    117376..117786
FT                   /note="Pro-kumamolisin, activation domain; Region:
FT                   Pro-kuma_activ; pfam09286"
FT                   /db_xref="CDD:150076"
FT                   /locus_tag="Bcen_3087"
FT   misc_feature    117859..118887
FT                   /note="Peptidase domain in the S53 family; Region:
FT                   Peptidases_S53; cd04056"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Bcen_3087"
FT   misc_feature    order(118075..118077,118087..118089,118225..118236,
FT                   118324..118326,118330..118335,118684..118686)
FT                   /note="active site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Bcen_3087"
FT   misc_feature    order(118075..118077,118087..118089,118684..118686)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Bcen_3087"
FT   misc_feature    order(118795..118800,118831..118833,118843..118845)
FT                   /note="calcium binding site; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Bcen_3087"
FT   gene            118991..120667
FT                   /db_xref="GeneID:4095997"
FT                   /locus_tag="Bcen_3088"
FT   CDS_pept        118991..120667
FT                   /locus_tag="Bcen_3088"
FT                   /gene_family="HOG000127651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S10, serine carboxypeptidase; KEGG:
FT                   bur:Bcep18194_B0371 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="GI:107025446"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="GeneID:4095997"
FT                   /translation="MDIDSASSGGVYPLHHGDHNSHGVPPTINPVALSHGRDQPFFDPV
FT                   AYGNGPDDSVTDTTEAAAITHHTILIDGKRIAYTATVGHLVTVDPSSSQPAAKIFYVAF
FT                   TADGAKEETRPVTFFYNGGPGSSSVFVLLGSFAPKRIKTSMPGFTPPAPYQIEDNPDSM
FT                   IDHSDLVFINPVGTGYSAAVAPNKNRDFWGVDQDADSLKQFIKRYLTKNNRWNSPKYLF
FT                   GESYGTARSCVLAYKLHEDGVDLNGVTLQSSILDYRQAGNPVGTLPTAAADAWYHKKLG
FT                   IKPAPADLGAFVEEVAQFARTDYLTALRAVPHANPATVQKLSAYTGIDTATLQSWGLDI
FT                   AGYDTRGNSLFLTTLLHAQGLALGSYDGRVTGISSGIAGKIDPNSGGNDPTMTAVTGVY
FT                   TAMWNSYLNEQLKFTSNSAFTDLNDQAFKNWDFSHIDPTGAQQGIDAQGNVILYTAGDL
FT                   AAVMALNVDLKVLSANGFYDFVTPFYQTVIDLQQMPLEDQKVRQNLSARFYPSGHMVYL
FT                   DGGSRTALKRDLATMYDATVSDTGARMRIRALQAKKTGGNA"
FT                   /protein_id="YP_622957.1"
FT   misc_feature    119207..120613
FT                   /note="Carboxypeptidase C (cathepsin A) [Amino acid
FT                   transport and metabolism]; Region: COG2939"
FT                   /db_xref="CDD:32762"
FT                   /locus_tag="Bcen_3088"
FT   misc_feature    119246..>119782
FT                   /note="Serine carboxypeptidase; Region: Peptidase_S10;
FT                   cl08270"
FT                   /db_xref="CDD:174992"
FT                   /locus_tag="Bcen_3088"
FT   gene            complement(120743..121591)
FT                   /db_xref="GeneID:4095998"
FT                   /locus_tag="Bcen_3089"