(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCA_3

ID   BURCA_3; SV 1; empty ; DNA; empty ; PRO; 1196094 BP.
XX
AC   NC_008062;
XX
PR   Project: 58371;
XX
DE   Burkholderia cenocepacia AU 1054 chromosome 3, complete sequence.
XX
OS   Burkholderia cenocepacia AU 1054
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1196094
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Complete sequence of chromosome 3 of Burkholderia cenocepacia AU 1054";
RL   Unpublished
XX
RN   [2]
RP   1-1196094
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (05-JUN-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1196094
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Lykidis,A., LiPuma,J.J., Konstantinidis,K.,
RA   Tiedje,J.M. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-MAY-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000380.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635680
CC   Source DNA and bacteria available from James M Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1196094
FT                   /strain="AU 1054"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia cenocepacia AU 1054"
FT                   /chromosome="3"
FT                   /db_xref="taxon:331271"
FT   gene            148..606
FT                   /db_xref="GeneID:4097265"
FT                   /locus_tag="Bcen_5482"
FT   CDS_pept        148..606
FT                   /locus_tag="Bcen_5482"
FT                   /gene_family="HOG000166648" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="(2Fe-2S)-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding; KEGG:
FT                   rso:RS05442 isoquinoline 1-oxidoreductase, alpha subunit"
FT                   /db_xref="GI:107028232"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="GeneID:4097265"
FT                   /translation="MVTLNINNRPAEIDADPSTPVLWVLRDNLGLTGTKFGCGTGDCGA
FT                   CTVHVDGRAARSCTLALSAVGSARITTSEHLADDALGKAVLDAWLRHDVAQCGYCQSGQ
FT                   MMSAAALLRGNKAPTDADIDRAMAGNLCRCATYQRIRAAIHDAASALA"
FT                   /protein_id="YP_625327.1"
FT   misc_feature    148..603
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs [Energy production and
FT                   conversion]; Region: CoxS; COG2080"
FT                   /db_xref="CDD:32263"
FT                   /locus_tag="Bcen_5482"
FT   misc_feature    151..>300
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcen_5482"
FT   misc_feature    order(247..252,259..261,268..270,274..285)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcen_5482"
FT   misc_feature    order(259..261,274..276,283..285)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcen_5482"
FT   misc_feature    361..585
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="Bcen_5482"
FT   gene            628..3120
FT                   /db_xref="GeneID:4097266"
FT                   /locus_tag="Bcen_5483"
FT   CDS_pept        628..3120
FT                   /locus_tag="Bcen_5483"
FT                   /gene_family="HOG000166090" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   KEGG: rso:RS05441 probable dehydrogenase, large chain
FT                   oxidoreductase protein"
FT                   /db_xref="GI:107028233"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:4097266"
FT                   /translation="MRIRTAGRPASTDAPHPDASPVAGTGSPSLGRRGFLKLTMAASGC
FT                   LALGIAPTRATAEAGKALPSSPPQAFLIIAPDNTVTIAVNRTESGQGVSTALPMALADE
FT                   LDADWRNVRTVLAPAGEPYKDPVTGIQMTGGATSVNHSFAQYRELGASARAMLVAAAAR
FT                   RWNVDPAACRTANGVVTAGNRSATYGELAPDAMAMPVPQRVPLKSPDQFRIIGKPTPRI
FT                   DARAMLDGTLKYGMDWRLPDMKVAVIARPPRFGGQVASYNAAAARAIKGVVEVVEIPVD
FT                   RGGTGVAVIADGYWPAKLGRDALQVTWKDSGSSVSSAEQMRAYKQLAASPGTVVRTASS
FT                   GSAPPPATRIQKEYEFPYLAHAPMEPLSCTVDVGPASCACGIKIWGGSSLQTADRAAVA
FT                   KALGVAPAKVQIFTLTSGGDYGRRSTPTSDYVVEAARVSAAYLAAGHLGPVKTIWTRED
FT                   DLRGGYYRPMVLHRVDIGVDGSGTVRDWQHVVVGQSVLKGSPLERTTIRKGGVDPALTE
FT                   GVADSPYGFPMQVSVHQTDADVPVQSWRSGGHTHTAFVMETLVDELAHAARQDPVAYRM
FT                   ARLSGPEHAPHRQALALAVDKSGYGTRTLPAGHAWGTAMHESAGTVVAYVTEVSIEAQQ
FT                   PRVHRVTAGVYAGRIVNPTGAEAQIQGGALFGLATTKPGFAIDVDHGAVRNAGFADYPP
FT                   VRMQEAPPVDVFFVPSDAHPTGLSDAGVPPIAPAVANGAFVLTGERMHALPFAPMLVAA
FT                   AAPAMPAAPAAAVDDDPYGDLAAGGCRMPRKAKPAALKPRTGQSQAGVGQAPSMPKFLR
FT                   PKRRAGIPCIDDLKKGTV"
FT                   /protein_id="YP_625328.1"
FT   misc_feature    811..2853
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit CoxL/CutL homologs [Energy production and
FT                   conversion]; Region: CoxL; COG1529"
FT                   /db_xref="CDD:31718"
FT                   /locus_tag="Bcen_5483"
FT   misc_feature    1675..>2076
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="Bcen_5483"
FT   misc_feature    <2497..2703
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="Bcen_5483"
FT   gene            complement(3221..4288)
FT                   /db_xref="GeneID:4097267"
FT                   /locus_tag="Bcen_5484"
FT   CDS_pept        complement(3221..4288)
FT                   /locus_tag="Bcen_5484"
FT                   /gene_family="HOG000269212" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_C7176 transcriptional regulator, AraC family"
FT                   /db_xref="GI:107028234"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:4097267"
FT                   /translation="MHGASAIEHDGRTSMAQFFETGWLADAACFNHDTLLLQSNDVDEV
FT                   RARVADVFKPHRLTPTGESRALHSCMHHARWGNLSLNLLDYGGGVSIEPGPLEHFFLLQ
FT                   IPLRGDAEIECGATRFVSSPGTASLLSPTLPLKMRWGDACPQVILRIEREVMERHAQRH
FT                   FGDDRRASVEFEPEFSLASPQGTCLAQLLPVLAGAIATDAHPLRHPLAFEQLESTLLNL
FT                   LLHGHPNSARDGTRRLPTALAPFYVRRVEEYIRAHLDEPLTIERLADLAGVSPSTLFAG
FT                   FRNRHGITPMGFVRQLRLQHVRDELLADDTPGLASVTDIALKWGFAHLGRFAIEYKRAF
FT                   GESPSATLRMRRVRG"
FT                   /protein_id="YP_625329.1"
FT   misc_feature    complement(<3467..>3616)
FT                   /note="DNA-binding transcriptional activator DcuR;
FT                   Provisional; Region: PRK10430"
FT                   /db_xref="CDD:170435"
FT                   /locus_tag="Bcen_5484"
FT   misc_feature    complement(3245..3508)
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Bcen_5484"
FT   misc_feature    complement(3242..>3343)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcen_5484"
FT   gene            4597..5844
FT                   /db_xref="GeneID:4097268"
FT                   /locus_tag="Bcen_5485"
FT   CDS_pept        4597..5844
FT                   /locus_tag="Bcen_5485"
FT                   /gene_family="HOG000269213" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; protein of unknown
FT                   function DUF1486; KEGG: bur:Bcep18194_C7177
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="GI:107028235"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="GeneID:4097268"
FT                   /translation="MNGRHIEIPAPDGGAFRAYLSTPAGGTGPGIVLCHEIFGANATMR
FT                   DVADYYAEEGYTVLVPDLFWRQAPGIELGDTAADFARAMALYREYDENKGVEDIGAALA
FT                   ELRERPECTGEAGVLGYCLGGKLAYLAACRLPGVAAAVSYYGVGIEHALDEAAHLHGRL
FT                   VLQIAELDRFCPPDAQQRIAAALAGRGGVEVYVYPGVDHAFARAGGDHFDKAAAVMAHQ
FT                   RAIAAFRAALGPRYDLSALWETHLKHEFDTRNVDATMATMVAEPYVNHIPTLTGGVGHD
FT                   ELKRFYTHHFVHANPPDTTITPISRTIAASQIVDELLFRFTHTTEIDWMLPGVAPTGKR
FT                   VEIPLVAIVKFRGDKLYHEHIYWDQASVLVQIGLLDPAGLPVAGVDTARKLLDETVPSN
FT                   GLMRRWHDSTPSTDAH"
FT                   /transl_table="11"
FT                   /protein_id="YP_625330.1"
FT   misc_feature    4642..5247
FT                   /note="Dienelactone hydrolase family; Region: DLH;
FT                   pfam01738"
FT                   /db_xref="CDD:145081"
FT                   /locus_tag="Bcen_5485"
FT   misc_feature    4900..>5034
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_5485"
FT   misc_feature    5344..5712
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="Bcen_5485"
FT   gene            5885..6673
FT                   /db_xref="GeneID:4097269"
FT                   /locus_tag="Bcen_5486"
FT   CDS_pept        5885..6673
FT                   /locus_tag="Bcen_5486"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_C7178 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="GI:107028236"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4097269"
FT                   /translation="MNALAGKVALVTGGATLIGAAVAQDLSRAGACVAILDLDADNGAR
FT                   VAASLGERALFIALDITDDRAIERAIATIVERFGAIDVLVNLACSYVDDGIHATRNDWL
FT                   AAMDVNVVSAAMLAKAVHPHMARRGGGAIVNFSSISAQCAQTGRWLYPTSKAAIRQLTR
FT                   SMAMDLAPDRIRVNSVSPGWTWSRVMDEMTHGDRAKTDRVAAPFHLLGRVGDPSEVAQV
FT                   VTFLCSDAASFVTGADYAVDGGYAAMGPEQAVPAIPRLAE"
FT                   /protein_id="YP_625331.1"
FT   misc_feature    5885..6670
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5486"
FT   misc_feature    5885..6589
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Provisional; Region: fabG; PRK07231"
FT                   /db_xref="CDD:168870"
FT                   /locus_tag="Bcen_5486"
FT   sig_peptide     5885..5956
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.997 at
FT                   residue 24"
FT                   /locus_tag="Bcen_5486"
FT                   /product="short chain dehydrogenase"
FT   gene            6738..7976
FT                   /db_xref="GeneID:4097270"
FT                   /locus_tag="Bcen_5487"
FT   CDS_pept        6738..7976
FT                   /locus_tag="Bcen_5487"
FT                   /gene_family="HOG000269234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7179 hypothetical protein"
FT                   /db_xref="GI:107028237"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:4097270"
FT                   /translation="MRRIAIVGAGQSGLQLAFALLDQGYHVTLATNRDAEQIRTGKVMS
FT                   SQCMFHTSLQIERDLGLNTWEEACPAVEGIGIAVPHPDGHGRKAIDWSSRLTRYAQSVD
FT                   QRVKMADWLDGVRRRGADVRIADIGVPELEALARSHDLVLLAAGKGDIVGLLGRDDARS
FT                   PFDRPQRALALTYVKGMTPSEPYSRVRFNLLPGIGEYFVFPALTTTGPCEIMVFEGIPG
FT                   GPLDCWADVKTPEQHLDRSLSFLQQYVPWEFERCRDVELTDPNGTLAGRFAPTVRKPFF
FT                   RLPSGRTVFGMADAVVVNDPITGQGSNNAAKCANAYFDAIVARGAAPFGEDWMQQTFEG
FT                   YWAYAQHVVRWTNSLLTPPPPHILELLGAAGQSPSLAKTIVDGFDDPRRFAPWWFEPSA
FT                   CAALIREHSVRAE"
FT                   /protein_id="YP_625332.1"
FT   misc_feature    6738..>6977
FT                   /note="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase; Validated; Region: gpsA; PRK00094"
FT                   /db_xref="CDD:166782"
FT                   /locus_tag="Bcen_5487"
FT   misc_feature    6744..>6824
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Bcen_5487"
FT   gene            7982..8509
FT                   /db_xref="GeneID:4097034"
FT                   /locus_tag="Bcen_5488"
FT   CDS_pept        7982..8509
FT                   /locus_tag="Bcen_5488"
FT                   /gene_family="HOG000115783" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin reductase-like, FMN-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: flavin reductase-like, FMN-binding; KEGG:
FT                   bur:Bcep18194_C7180 flavin reductase-like, FMN-binding"
FT                   /db_xref="GI:107028238"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="GeneID:4097034"
FT                   /translation="METTVTDRAALDPMQLRAAFGQFPTGVTVITTCAADGRKVGLTAN
FT                   SFSSLSLDPPLVLWSLRKVAPSRPDFVAATHFAINILAHDQIDLSRRFATPSADKFDGV
FT                   PHVASESGGVPCLGGASARFVCRNVGHYEGGDHLLFIGEIERFDAFGKAPLVFHAGQYR
FT                   AIADHPDLLRAI"
FT                   /protein_id="YP_625333.1"
FT   misc_feature    8039..8479
FT                   /note="Flavin Reductases; Region: FlaRed; cl00801"
FT                   /db_xref="CDD:154006"
FT                   /locus_tag="Bcen_5488"
FT   gene            8546..9502
FT                   /db_xref="GeneID:4097035"
FT                   /locus_tag="Bcen_5489"
FT   CDS_pept        8546..9502
FT                   /locus_tag="Bcen_5489"
FT                   /gene_family="HOG000269235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein involved in MetA-pathway of phenol
FT                   degradation-like"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7181 protein involved in
FT                   MetA-pathway of phenol degradation-like"
FT                   /db_xref="GI:107028239"
FT                   /db_xref="GeneID:4097035"
FT                   /translation="MKLGSRLLVAAGFAIAGLASHAPAHAADLPAVNLGMTSFLDGMPP
FT                   AGAGWYGTQYLQYYTAGRVNDNAGNKVGLPKQDIDLFAGLSQLVYQSPLTFAGMHPGLD
FT                   VILPWIASARTDDGIGNVALNARAGFGDLLIGPFIQFDPVMGTQGPRFAQRVEFQFIVP
FT                   TGAYDPSRAINPGSHFWSFDPYWAATLWLTPKWTVSWRLHYLWNATNHQPATALGPDVT
FT                   STQAGQALHVNFATEYEVRPGLRLGLNGYWLRQTTDMKANGQDVPGAREAVFAIGPGAM
FT                   VSFSPHDHLLFNAYFETYARNRPQGTRMVLRYVHHFQ"
FT                   /protein_id="YP_625334.1"
FT   sig_peptide     8546..8626
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT                   /locus_tag="Bcen_5489"
FT                   /product="hypothetical protein"
FT   misc_feature    8639..9496
FT                   /note="Protein involved in meta-pathway of phenol
FT                   degradation [Energy production and conversion]; Region:
FT                   COG4313"
FT                   /db_xref="CDD:34035"
FT                   /locus_tag="Bcen_5489"
FT   gene            complement(9782..10756)
FT                   /db_xref="GeneID:4097036"
FT                   /locus_tag="Bcen_5490"
FT   CDS_pept        complement(9782..10756)
FT                   /locus_tag="Bcen_5490"
FT                   /gene_family="HOG000248661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bur:Bcep18194_C7193 putative Flp pilus assembly protein
FT                   TadC"
FT                   /db_xref="GI:107028240"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:4097036"
FT                   /translation="MQNLSVVQAVMLGGLFIFVAGGVLVAMLLFAPRGIQRRLQQAGGT
FT                   GAGGVAGAGDGDDMASRWVAKLVELSSPISKLSVPKEGWENSPLRIRLMNAGWRNQSAA
FT                   AVYFTAKTMLALGLPCAALLALITTSLGDERALLSLILVALAGIGYYIPNIVLSQRVKV
FT                   RQRKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFRSEVVASELDLLLLEMRSGF
FT                   TKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAA
FT                   KIALKLLFPLIFCIFPALMMVLLGPAMIHVYRVLLPTFVGVAP"
FT                   /protein_id="YP_625335.1"
FT   misc_feature    complement(9830..>10339)
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Bcen_5490"
FT   gene            complement(10793..11770)
FT                   /db_xref="GeneID:4097037"
FT                   /locus_tag="Bcen_5491"
FT   CDS_pept        complement(10793..11770)
FT                   /locus_tag="Bcen_5491"
FT                   /gene_family="HOG000248650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bur:Bcep18194_C7194 Flp pilus assembly protein TadB"
FT                   /db_xref="GI:107028241"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:4097037"
FT                   /translation="MNAIFYGFVILTFVAVVLSIEGIYQWWNARHGAAARRIESRIRAM
FT                   SAGGNVQQERLSILKKRMLDESKPFDRLLLRLPRVHALDLVIQQSGLDWTLPKLITLSA
FT                   TFAALAWFVASFARLPQLAAVPVALVAGWLPMTYVLRCRAKRMRKLERQLPDICDMIAR
FT                   ALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYGVSLHDALTNLATRVPVQDLRYF
FT                   VIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVLSAEGRLSAWILGLLPFGTAAV
FT                   MALLNREFLLVLWEDPAGIRMVGTMLVSMLFGLFWIRRIVRIRV"
FT                   /protein_id="YP_625336.1"
FT   misc_feature    complement(10796..11605)
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Bcen_5491"
FT   gene            complement(11804..13168)
FT                   /db_xref="GeneID:4097038"
FT                   /locus_tag="Bcen_5492"
FT   CDS_pept        complement(11804..13168)
FT                   /locus_tag="Bcen_5492"
FT                   /gene_family="HOG000119936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bur:Bcep18194_C7195 Flp pilus assembly protein ATPase CpaF"
FT                   /db_xref="GI:107028242"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="GeneID:4097038"
FT                   /translation="MSLREQMSLHRAQPLAASDAAGPAHSSVRDAYQKLRREIHLAVLE
FT                   RVELERLSRLHQDQIRMEIGALIARILDEERLPANDIERRQLAIDVYDEMFGFGPLEAL
FT                   LRDPGISDILVNTYRQVYVERCGQLELTDVTFYDDAHLMKVIEKIVSRVGRRIDESSPM
FT                   VDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRYHSLTPPMAELLDALSR
FT                   AKVNVLVSGGTGSGKTTLLNILSGFIPRNERIVTIEDAAELQLQQPHVLRLETRPPNIE
FT                   GKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATIHANTPRDAL
FT                   TRLENMVSVSGLTLPPKTMRQQIASAISVVVQAARLTDGKRKIVSIQELTGMEGDIINM
FT                   QEIFTFKRTGVDRDGAVRGHFCATGVRPKFAERLQAFGINLPDSLYDPSVHYETD"
FT                   /protein_id="YP_625337.1"
FT   misc_feature    complement(11936..13003)
FT                   /note="Flp pilus assembly protein, ATPase CpaF
FT                   [Intracellular trafficking and secretion]; Region: CpaF;
FT                   COG4962"
FT                   /db_xref="CDD:34569"
FT                   /locus_tag="Bcen_5492"
FT   misc_feature    complement(12014..12571)
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcen_5492"
FT   misc_feature    complement(order(12035..12037,12452..12469,12560..12562))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcen_5492"
FT   misc_feature    complement(order(12455..12463,12473..12478))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcen_5492"
FT   misc_feature    complement(order(12050..12052,12146..12148,12155..12157,
FT                   12167..12175,12203..12208,12215..12217,12227..12229,
FT                   12266..12268,12272..12280,12347..12352,12356..12367,
FT                   12386..12388,12410..12412,12467..12472))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcen_5492"
FT   misc_feature    complement(12248..12265)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcen_5492"
FT   gene            complement(13187..14395)
FT                   /db_xref="GeneID:4097039"
FT                   /locus_tag="Bcen_5493"
FT   CDS_pept        complement(13187..14395)
FT                   /locus_tag="Bcen_5493"
FT                   /gene_family="HOG000269246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_C7196 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="GI:107028243"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:4097039"
FT                   /translation="MINILVASDDTARLTQIARLVADCGRYRTTRATGRPSQIEHRTDG
FT                   LDAFDILLIDGTSLEPSELSAIERICRAHAGLTCILVTADASPHVLLDAMRAGARDVLQ
FT                   WPLDPQALGNALGRAAAQSTRRDTDDTRIVSFMSCKGGVGTSFAAGNIAFEIAEGFKRR
FT                   VLLIDLNQQFADAAFLVSDETPPSTLPQLCAQIERLDGAFLDASVAHVTENFHVLAGAG
FT                   DPVKAAEMREDALEWILGVAAPRYDFVIFDVGVGINPLSMVALDRSDQIQIVLQPAMPH
FT                   VRAGRRLLEILVSLGYSTDQLRLIVNRTTRASERTRAALEEVLGLHAACTIPDDADTVL
FT                   EAINQGHPVSRLARGSAVVRALQGCAKQLVDGEVRAGRGATHSEPLMSRLFGRKATPKL
FT                   KSM"
FT                   /protein_id="YP_625338.1"
FT   misc_feature    complement(14030..14389)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="Bcen_5493"
FT   misc_feature    complement(13211..14290)
FT                   /note="Flp pilus assembly protein, ATPase CpaE
FT                   [Intracellular trafficking and secretion]; Region: CpaE;
FT                   COG4963"
FT                   /db_xref="CDD:34570"
FT                   /locus_tag="Bcen_5493"
FT   misc_feature    complement(<13856..13999)
FT                   /note="This protein family consists of proteins similar to
FT                   the cpaE protein of the Caulobacter pilus assembly and the
FT                   orf4 protein of Actinobacillus pilus formation gene
FT                   cluster. The function of these proteins are unkown. The
FT                   Caulobacter pilus assembly...; Region: CpaE_like; cd03111"
FT                   /db_xref="CDD:73340"
FT                   /locus_tag="Bcen_5493"
FT   misc_feature    complement(13475..>13657)
FT                   /note="This protein family consists of proteins similar to
FT                   the cpaE protein of the Caulobacter pilus assembly and the
FT                   orf4 protein of Actinobacillus pilus formation gene
FT                   cluster. The function of these proteins are unkown. The
FT                   Caulobacter pilus assembly...; Region: CpaE_like; cd03111"
FT                   /db_xref="CDD:73340"
FT                   /locus_tag="Bcen_5493"
FT   gene            complement(14418..14861)
FT                   /db_xref="GeneID:4097040"
FT                   /locus_tag="Bcen_5494"
FT   CDS_pept        complement(14418..14861)
FT                   /locus_tag="Bcen_5494"
FT                   /gene_family="HOG000269259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TadE-like"
FT                   /transl_table="11"
FT                   /note="PFAM: TadE-like; KEGG: bur:Bcep18194_C7197 TadE-like
FT                   protein"
FT                   /db_xref="GI:107028244"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="GeneID:4097040"
FT                   /translation="MNARHFPLSRRRAQRGVAIVEFALIASVLIMLLIGIFEFGRVLFY
FT                   WNTASEAVRLGARTAVVCDVNAAGVVKRVRSLLPLLSSANVSVNYTPSSCDVNTCSFVT
FT                   VSVTNVTVKTMIPFMNVTVRMPPFTTTLPRESLNSATGGSACN"
FT                   /protein_id="YP_625339.1"
FT   misc_feature    complement(14688..14816)
FT                   /note="TadE-like protein; Region: TadE; pfam07811"
FT                   /db_xref="CDD:149078"
FT                   /locus_tag="Bcen_5494"
FT   gene            complement(14858..15391)
FT                   /db_xref="GeneID:4097041"
FT                   /locus_tag="Bcen_5495"
FT   CDS_pept        complement(14858..15391)
FT                   /locus_tag="Bcen_5495"
FT                   /gene_family="HOG000269270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TadE-like"
FT                   /transl_table="11"
FT                   /note="PFAM: TadE-like; KEGG: bur:Bcep18194_C7198 TadE-like
FT                   protein"
FT                   /db_xref="GI:107028245"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="GeneID:4097041"
FT                   /translation="MKKPPIRRSRTRGVVAVEFALVLMPMIMLATGVAEFGRAIYQYET
FT                   LTKATRDAARYLSVWLPTDSAYPVSQAQCLVVYGSTTCGSSGTELVPGLTTSMVTICDA
FT                   QRTTGCSDASDPSQFANLPTYDSNNNAASGTATGAINVVEVKISGYQYQPIPAYPWLPS
FT                   ITFGNIVTVMRQVS"
FT                   /protein_id="YP_625340.1"
FT   misc_feature    complement(<15014..15376)
FT                   /note="Flp pilus assembly protein TadG [Intracellular
FT                   trafficking and secretion]; Region: TadG; COG4961"
FT                   /db_xref="CDD:34568"
FT                   /locus_tag="Bcen_5495"
FT   misc_feature    complement(15227..15355)
FT                   /note="TadE-like protein; Region: TadE; pfam07811"
FT                   /db_xref="CDD:149078"
FT                   /locus_tag="Bcen_5495"
FT   gene            complement(15405..16676)
FT                   /db_xref="GeneID:4097042"
FT                   /locus_tag="Bcen_5496"
FT   CDS_pept        complement(15405..16676)
FT                   /locus_tag="Bcen_5496"
FT                   /gene_family="HOG000269281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7199 hypothetical protein"
FT                   /db_xref="GI:107028246"
FT                   /db_xref="GeneID:4097042"
FT                   /translation="MNRAARYPKVTRRSLHRQRGAVAIIVGLALAVMIGFVGLALDLGK
FT                   LYVTRSELQNSADACALSAARDLTSAISLSVAEADGIAAGHLNFVFFQKTSVQMSTNAN
FT                   VTFSDSLTNPFLTKNAVTTPANIKYVQCTATLSNIAHWFIEVLNVLPGTKLANAAEVSA
FT                   SAIATVGGGQTTCAIPVFVCRGPSDPAYKVGDWISSPSGSSSTYGPGNFGWAALDGSTN
FT                   ETTLASELSGNTCNITSPPDLATTGMKSASQRAWNTRFGIYTNGANGSSGQPDFTGYAY
FT                   VGPNYGPPGTAGIKGDAYTQFVADRASFKPYQGDGAPPSGSGIATNGTATASNYSTYGS
FT                   DRRLALAPEGDCSTLKGSSGKVHVTQWDCVLMLDPLPFSAGSGAVVAHLEYLGSSVSGN
FT                   NPCATHGLPGSGSASGTQVPMLVQ"
FT                   /protein_id="YP_625341.1"
FT   sig_peptide     complement(16554..16676)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.926 at
FT                   residue 41"
FT                   /locus_tag="Bcen_5496"
FT                   /product="hypothetical protein"
FT   gene            complement(16702..17022)
FT                   /db_xref="GeneID:4097043"
FT                   /locus_tag="Bcen_5497"
FT   CDS_pept        complement(16702..17022)
FT                   /locus_tag="Bcen_5497"
FT                   /gene_family="HOG000269292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7200 hypothetical protein"
FT                   /db_xref="GI:107028247"
FT                   /db_xref="GeneID:4097043"
FT                   /translation="MKPSKGKLMKSAYLVFVRRAALAAPLAFALAGCMSSTPVWDSRFG
FT                   DSVRTVMHAQIIDPHAGERPVSAPGVDGGAAASALDNYDKSFKQVQPPTNAFVIGIGKS
FT                   TQ"
FT                   /protein_id="YP_625342.1"
FT   sig_peptide     complement(16915..17022)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.710 at
FT                   residue 36"
FT                   /locus_tag="Bcen_5497"
FT                   /product="hypothetical protein"
FT   gene            complement(17019..18947)
FT                   /db_xref="GeneID:4097044"
FT                   /locus_tag="Bcen_5498"
FT   CDS_pept        complement(17019..18947)
FT                   /locus_tag="Bcen_5498"
FT                   /gene_family="HOG000259656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II and III secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   transport-associated; KEGG: bur:Bcep18194_C7201 Flp pilus
FT                   assembly protein secretin CpaC"
FT                   /db_xref="GI:107028248"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:4097044"
FT                   /translation="MKIKPQRTGTGPLRTRVARGTMMAAILCSGWLTVYGALAQEGIES
FT                   AVLTKGGASAPAAVGKGPMQMTISMAPVPAAAPAASAGPLRGPNCVGAVRESTSVAVPL
FT                   GKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIVQGRSGACRVIDV
FT                   AVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQAVQIAHAYGDSAG
FT                   DAAGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQGGFGSWSGALVS
FT                   NLLAGVASGAVFNKANNKPFSIAADAQNTDNLVKILAEPNLVTISGQEATFLAGGKIFI
FT                   PIPQSGSNGVSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVTLSASNI
FT                   GGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGALKAIPGVGEVPVLGALFRST
FT                   SFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVFATGNMEGRGGVRKAGAQ
FT                   PMQPANGAAAPQTPAQAPAPAPAPKSEAPVAPAALPAPRTPQDADVQPPVPAEPPKAPA
FT                   PVAAAAPQSDAATAARVARIEAAAARLAAAGPEPSAQPAARPKHRSAAAPKAQIARAGA
FT                   EPQSTDR"
FT                   /protein_id="YP_625343.1"
FT   sig_peptide     complement(18828..18947)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.764 at
FT                   residue 40"
FT                   /locus_tag="Bcen_5498"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(17430..18659)
FT                   /note="Flp pilus assembly protein, secretin CpaC
FT                   [Intracellular trafficking and secretion]; Region: CpaC;
FT                   COG4964"
FT                   /db_xref="CDD:34571"
FT                   /locus_tag="Bcen_5498"
FT   misc_feature    complement(17517..18029)
FT                   /note="Bacterial type II and III secretion system protein;
FT                   Region: Secretin; cl02829"
FT                   /db_xref="CDD:164025"
FT                   /locus_tag="Bcen_5498"
FT   gene            complement(19052..19891)
FT                   /db_xref="GeneID:4097045"
FT                   /locus_tag="Bcen_5499"
FT   CDS_pept        complement(19052..19891)
FT                   /locus_tag="Bcen_5499"
FT                   /gene_family="HOG000269313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp pilus assembly CpaB"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp pilus assembly CpaB; KEGG:
FT                   bur:Bcep18194_C7202 Flp pilus assembly CpaB"
FT                   /db_xref="GI:107028249"
FT                   /db_xref="InterPro:IPR010728"
FT                   /db_xref="GeneID:4097045"
FT                   /translation="MKNSRALMMLVVAMVAGLAAVVFASRWLVQTSTSSVTSVAVATTD
FT                   LNLGEPLGPNQIHMVSWPAGSVPTGAFTDTKTLEGRVVRTSLARGEPVIESKLAPVGTK
FT                   GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEH
FT                   ILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTT
FT                   GGATKLTLLGKEPVPEAAPAPVHVRPVRVHVASHAAPEVRRDCVGVLTGVKGSVECF"
FT                   /protein_id="YP_625344.1"
FT   sig_peptide     complement(19817..19891)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.889 at
FT                   residue 25"
FT                   /locus_tag="Bcen_5499"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(19241..19759)
FT                   /note="SAF domain; Region: SAF; cl00555"
FT                   /db_xref="CDD:174283"
FT                   /locus_tag="Bcen_5499"
FT   gene            complement(19927..21327)
FT                   /db_xref="GeneID:4097046"
FT                   /locus_tag="Bcen_5500"
FT   CDS_pept        complement(19927..21327)
FT                   /locus_tag="Bcen_5500"
FT                   /gene_family="HOG000269324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7203 ATPase"
FT                   /db_xref="GI:107028250"
FT                   /db_xref="GeneID:4097046"
FT                   /translation="MNTNHTEPRRDAQVARLPDPPPSREAHTKPGAQLPPAPRSLAETG
FT                   LSMAFVGGLVLKSTLVLGRPSYGDLVERHCLPLAVLDEVFAFLVREHLVELTHRGATDL
FT                   DVTFRLTDAGRVLALEERERSGYSGPAPVTLDAYLASVAAHSVRKLHIGQSDVWAAFEG
FT                   IVIDTAVLDAAAAALNAGRPLLIYGPAGSGKTFLAERLGALMHGRVPIPYAICAAGEVI
FT                   EVYDPLVHVDVGSQAGGQSVDRRWRLCERPVVMSGGELTLDELDLRRDAAAGFYQAPPH
FT                   MKANMGMYVVDDLGRQRVEPRDLLNRWLRPLDRGVDFMTLESGNRFVMPFDVWPVFSSN
FT                   LAPEQFCDDAFMRRLGSKLHVGAMSIDDYRAVYDAACASLGLVSASDAFDFLLHRLHLP
FT                   TGKAFLACFPADLLRLVAAGARYRGDPPEVTHDALYDAWASYFGAAPERDGSHPPPVER
FT                   GGRTFITG"
FT                   /protein_id="YP_625345.1"
FT   misc_feature    complement(<20299..>21012)
FT                   /note="Predicted ATPase with chaperone activity
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG0606"
FT                   /db_xref="CDD:30951"
FT                   /locus_tag="Bcen_5500"
FT   misc_feature    complement(<20683..20772)
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="Bcen_5500"
FT   misc_feature    complement(order(20740..20751,20764..20766))
FT                   /note="active site"
FT                   /db_xref="CDD:73295"
FT                   /locus_tag="Bcen_5500"
FT   gene            complement(21371..21910)
FT                   /db_xref="GeneID:4097047"
FT                   /locus_tag="Bcen_5501"
FT   CDS_pept        complement(21371..21910)
FT                   /locus_tag="Bcen_5501"
FT                   /gene_family="HOG000269335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   bur:Bcep18194_C7204 peptidase A24A, prepilin type IV"
FT                   /db_xref="GI:107028251"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="GeneID:4097047"
FT                   /translation="MLPVAPPYPVPLCVTLLAVAAASTDIATRRIPNRLVLLGLAGALV
FT                   AQCLLQGVPAGVLGWLAGAATGFGLLLPFYLLRGMAAGDVKLMLAIGAWVGAEMTFYIV
FT                   LATFLAGGIGAIAYALLRGRMRQMWTNVRTLIVRRSQAARAEADDGPVEIASVGTLPYG
FT                   VAIAVGTLGTLFASCA"
FT                   /protein_id="YP_625346.1"
FT   misc_feature    complement(21587..21877)
FT                   /note="Type IV leader peptidase family; Region:
FT                   Peptidase_A24; cl02077"
FT                   /db_xref="CDD:154734"
FT                   /locus_tag="Bcen_5501"
FT   gene            complement(21939..22145)
FT                   /db_xref="GeneID:4097048"
FT                   /locus_tag="Bcen_5502"
FT   CDS_pept        complement(21939..22145)
FT                   /locus_tag="Bcen_5502"
FT                   /gene_family="HOG000269336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp/Fap pilin component"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG:
FT                   bur:Bcep18194_C7205 Flp/Fap pilin component"
FT                   /db_xref="GI:107028252"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="GeneID:4097048"
FT                   /translation="MQTIMRVARGWIADEQGVTSIEYALLASMFAVAVLGSVVTLKGSL
FT                   GDAYEMIAAAVTAAVSTALSMVS"
FT                   /protein_id="YP_625347.1"
FT   misc_feature    complement(21990..22112)
FT                   /note="Flp/Fap pilin component; Region: Flp_Fap; cl01585"
FT                   /db_xref="CDD:120751"
FT                   /locus_tag="Bcen_5502"
FT   gene            complement(22228..22419)
FT                   /db_xref="GeneID:4097049"
FT                   /locus_tag="Bcen_5503"
FT   CDS_pept        complement(22228..22419)
FT                   /locus_tag="Bcen_5503"
FT                   /gene_family="HOG000248595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp/Fap pilin component"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG:
FT                   bur:Bcep18194_C7206 Flp/Fap pilin component"
FT                   /db_xref="GI:107028253"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="GeneID:4097049"
FT                   /translation="MSKFIQQVGRFVRDEDGVTAIEYGLIAALIAIGIIAALSTVGKDL
FT                   KTVFTTIADDLDSAVAAI"
FT                   /protein_id="YP_625348.1"
FT   misc_feature    complement(22237..22398)
FT                   /note="Flp/Fap pilin component; Region: Flp_Fap; cl01585"
FT                   /db_xref="CDD:120751"
FT                   /locus_tag="Bcen_5503"
FT   gene            complement(22559..22750)
FT                   /db_xref="GeneID:4097050"
FT                   /locus_tag="Bcen_5504"
FT   CDS_pept        complement(22559..22750)
FT                   /locus_tag="Bcen_5504"
FT                   /gene_family="HOG000248595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp/Fap pilin component"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG:
FT                   bur:Bcep18194_C7207 Flp/Fap pilin component"
FT                   /db_xref="GI:107028254"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="GeneID:4097050"
FT                   /translation="MSRIIEKIAWFVEDQDGVTAIEYGLIAALIAIGIVGALTTVGTDL
FT                   KTVFNTVADDLDSVVAAI"
FT                   /protein_id="YP_625349.1"
FT   gene            23256..23702
FT                   /db_xref="GeneID:4097051"
FT                   /locus_tag="Bcen_5505"
FT   CDS_pept        23256..23702
FT                   /locus_tag="Bcen_5505"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028255"
FT                   /db_xref="GeneID:4097051"
FT                   /translation="MPEPPGRHVVDCRANAYAKSGPSRAESRRTKGSGDPHGRPSNARQ
FT                   PKCFNFDICGAGECSRHETPSPRCTKGLKNFLGIFPNPASRSGVAGPAARTAGKNRGMF
FT                   QARNTNPGNGVFSYQKWRFSPESLNTFNVGRPCAVCITRFFLQQ"
FT                   /protein_id="YP_625350.1"
FT   gene            23800..25038
FT                   /db_xref="GeneID:4097052"
FT                   /locus_tag="Bcen_5506"
FT   CDS_pept        23800..25038
FT                   /locus_tag="Bcen_5506"
FT                   /gene_family="HOG000165186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7208 hypothetical protein"
FT                   /db_xref="GI:107028256"
FT                   /db_xref="GeneID:4097052"
FT                   /translation="MYTANRGTRDRAIRCAQWLTADRIIPYSCIMLMLFAALVIVWGVV
FT                   TNGFTSNATARPGTDFSVFWTASHLVLQGHAASAYDASSFVQAEFAHFGAFLQHRPLPW
FT                   LYPPTMLLFIAPVALVPFLPAYFLFFAGSLLCYALAVSRLSGLRAHLPVPRAAMVVVIA
FT                   YSAVCMSALFGQNSILTAGLAALALHLLGKRPVLAGVLIGLLAIKPQLAVVFPFVLIAT
FT                   RAWRTFAAAAISATLFAAAGVALAGPAALHGLARAMSTVREQHFMLASYWLASPTPFAA
FT                   LRLAGAPVAAALAAQAAVALLAIAAAVSVWRRTHDMRLRGAVLAVATLLTTPYLWHYEL
FT                   TWLGIAIFCLIAHGLDEGWLPGDQGILVIAWLLPIFEMFNRLMKLPQIGPVVLLAVLFV
FT                   VVRRTALASRGKQ"
FT                   /protein_id="YP_625351.1"
FT   misc_feature    24109..>24456
FT                   /note="Protein of unknown function (DUF2029); Region:
FT                   DUF2029; cl09812"
FT                   /db_xref="CDD:175042"
FT                   /locus_tag="Bcen_5506"
FT   gene            25035..26414
FT                   /db_xref="GeneID:4097053"
FT                   /locus_tag="Bcen_5507"
FT   CDS_pept        25035..26414
FT                   /locus_tag="Bcen_5507"
FT                   /gene_family="HOG000165186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7209 hypothetical protein"
FT                   /db_xref="GI:107028257"
FT                   /db_xref="GeneID:4097053"
FT                   /translation="MKAPSFARHAHSAIDVHPELPIAGPRRHPHWLNRDRVRVYAAAVL
FT                   LTELLFIGLYLIRVILSKHGVLEPLSPDFSPIWSAAWLAAHGHGADAWHYATLFAIEKS
FT                   AVPTITLANGTQPWLYPPTMLLLVLPLGWLPYTLALVLWLGITYALFAATIHATVQRDA
FT                   AWLCALAFPGAFLTVIVGQTSLFTATLAAVGLLALNRRPVCAGICFGLLTMKPQLAVLF
FT                   PLALLCAGQWRALAAWAATIAVSALLATLAFGVGPWVAFAHVIADVYAIVGTGRAQLAR
FT                   MPTLFALATMAGWPALVARGLQLLSAAVAAIAVVYAWRGACSYALRAATLACACLLVSP
FT                   YLYDYDLTWYGIVIAWYARYALTRGWRRFDREWLMLLWPMPLAGLAVVPHLSFQFMPLV
FT                   TLASLALLVSRIAQERRDVPSMPDARDTSTETGFAHPSRAHHRPAHGMRRTGRPTLGAG
FT                   R"
FT                   /protein_id="YP_625352.1"
FT   misc_feature    25449..26006
FT                   /note="Protein of unknown function (DUF2029); Region:
FT                   DUF2029; cl09812"
FT                   /db_xref="CDD:175042"
FT                   /locus_tag="Bcen_5507"
FT   gene            26439..27482
FT                   /db_xref="GeneID:4096734"
FT                   /locus_tag="Bcen_5508"
FT   CDS_pept        26439..27482
FT                   /locus_tag="Bcen_5508"
FT                   /gene_family="HOG000283247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bur:Bcep18194_C7210 glycosyl transferase, family 2"
FT                   /db_xref="GI:107028258"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:4096734"
FT                   /translation="MRESIYTPLVSLVVPFYNEGEAVERFFDVVIPLLSAIDAIRFEIV
FT                   CVNDGSRDDTLERLVRIGAAERRVRVIDLTRNFGKEAALTAGLDEAAGDAVIPLDADLQ
FT                   DPPSLIPVMIEHWRDGAEVVAAKRSNRACDSFAKRTAAALYYRVHNLLSDVKLPENVGD
FT                   FRLMDRKVVNALRNLPERHRFMKGLFAWVGYKTVIVEYQRDPRSAGHSKFSGWKLWNFA
FT                   LEGITSFSTVPLRSWTYIGVGIAALAFVYGAFIILRTLLFGNPVLGYASLISVTLFIGG
FT                   IELIGIGVVGEYVGRIYDESKQRPVYLIRRRYQAHGKVIELPVARDARRQPARRRAQPV
FT                   RARIGAR"
FT                   /protein_id="YP_625353.1"
FT   misc_feature    26472..27020
FT                   /note="Bacterial DPM1_like enzymes are related to
FT                   eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen_5508"
FT   misc_feature    order(26481..26483,26487..26489,26742..26744)
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen_5508"
FT   misc_feature    order(26583..26585,26739..26744)
FT                   /note="Putative Catalytic site; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen_5508"
FT   misc_feature    26736..26744
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen_5508"
FT   gene            27495..27878
FT                   /db_xref="GeneID:4096735"
FT                   /locus_tag="Bcen_5509"
FT   CDS_pept        27495..27878
FT                   /locus_tag="Bcen_5509"
FT                   /gene_family="HOG000155113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GtrA-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: GtrA-like protein; KEGG: bur:Bcep18194_C7211
FT                   hypothetical protein"
FT                   /db_xref="GI:107028259"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="GeneID:4096735"
FT                   /translation="MSTLLQAERTRLVRFGVSGLCSTAIHVLVATALFARLDAAPVTAN
FT                   AIAFLCATAFSYLANTLWSFSSTVRTRNAIRFLAVMLAGFVETMLIARAAEALDAPRAM
FT                   GVVAIALLIPPTTFVLHRLWTYR"
FT                   /protein_id="YP_625354.1"
FT   misc_feature    27534..27872
FT                   /note="GtrA-like protein; Region: GtrA; cl00971"
FT                   /db_xref="CDD:154117"
FT                   /locus_tag="Bcen_5509"
FT   gene            28174..28677
FT                   /db_xref="GeneID:4096736"
FT                   /locus_tag="Bcen_5510"
FT   CDS_pept        28174..28677
FT                   /locus_tag="Bcen_5510"
FT                   /gene_family="HOG000266303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7212 hypothetical protein"
FT                   /db_xref="GI:107028260"
FT                   /db_xref="GeneID:4096736"
FT                   /translation="MSRVTDVLVSFDTETILKKYPNPSKNPAAPTLIDWRYVYMVTNQD
FT                   NVISGQAGGELDLKAQVGDLIRWRETSLSLGFENQVVFYKFIGNVGNDLISTPTPRVAE
FT                   ASIPVPNTSKPEVPTCQKVANYYWSSECLKVGRVTYHFQFQIIDRNCQSQGCFSWDPFI
FT                   SIHN"
FT                   /protein_id="YP_625355.1"
FT   misc_feature    28174..28671
FT                   /note="Inclusion body protein; Region: PixA; pfam12306"
FT                   /db_xref="CDD:152741"
FT                   /locus_tag="Bcen_5510"
FT   gene            28743..29282
FT                   /db_xref="GeneID:4096737"
FT                   /locus_tag="Bcen_5511"
FT   CDS_pept        28743..29282
FT                   /locus_tag="Bcen_5511"
FT                   /gene_family="HOG000266315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7213 hypothetical protein"
FT                   /db_xref="GI:107028261"
FT                   /db_xref="GeneID:4096737"
FT                   /translation="MSGVRCDALAIVDAVTLLSAYPDASRDADVPTVIDGRHIYVLSPG
FT                   DAGQVSHNDNRLFAGLSPGDQLRLRETALALRAEVTVLFVRFALKDAGIVTPLEAEIRD
FT                   AATPVPDGDDLLHPSCRPMKDHFWHSEVLAPGTTTCTADFAVLDRDGAVSGYFRWETTI
FT                   EIAGSRPDTKRPDVKP"
FT                   /protein_id="YP_625356.1"
FT   misc_feature    28746..29240
FT                   /note="Inclusion body protein; Region: PixA; pfam12306"
FT                   /db_xref="CDD:152741"
FT                   /locus_tag="Bcen_5511"
FT   gene            complement(29355..30296)
FT                   /db_xref="GeneID:4096738"
FT                   /locus_tag="Bcen_5512"
FT   CDS_pept        complement(29355..30296)
FT                   /locus_tag="Bcen_5512"
FT                   /gene_family="HOG000190583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bur:Bcep18194_B1534 ABC amino acid transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="GI:107028262"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4096738"
FT                   /translation="MSRPAFAVTRIARVLAAALIAGSAVAAHAASFDLSPEQPARQRGA
FT                   VNPAVEQALPAGFRFAEANTLTIGIAPNLPPLSTYATDARTVVGFDPDLAQLIADSVGR
FT                   KLKIVPLAWADWPLALQSGKVDAVISNVTVTEQRKEKFDFSTYRKDQLGFYVKTGSKLA
FT                   AIREPKDVAGLRVVTDSGTNQEKILLEWNRQNVARGLAPVEIQYYADAAERWVALQSGR
FT                   VDTIFSVNSMLAYQASLRGDAKLIGTVSGGWPRTADIAITTRKGSGLADPLTLAINALI
FT                   ANGSYRKALDHWQLDAEAIERSQTNPPGLPRT"
FT                   /protein_id="YP_625357.1"
FT   sig_peptide     complement(30207..30296)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT                   /locus_tag="Bcen_5512"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(29418..30101)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5512"
FT   misc_feature    complement(29418..30101)
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="Bcen_5512"
FT   misc_feature    complement(order(29610..29612,29748..29750,29883..29885,
FT                   29958..29960,30075..30077))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5512"
FT   misc_feature    complement(order(29631..29633,29649..29651,29661..29663))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5512"
FT   misc_feature    complement(order(29517..29522,29529..29540))
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5512"
FT   gene            complement(30383..31504)
FT                   /db_xref="GeneID:4096739"
FT                   /locus_tag="Bcen_5513"
FT   CDS_pept        complement(30383..31504)
FT                   /locus_tag="Bcen_5513"
FT                   /gene_family="HOG000266326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu3801 hypothetical protein"
FT                   /db_xref="GI:107028263"
FT                   /db_xref="GeneID:4096739"
FT                   /translation="MTYLADARIALTAAESAHIRQTLGALAYDPAGGAGYISAVRKLAY
FT                   NAFPDRIVDAFDRAKAPTADAHGSIEIDNLPIDDDVKGSPRFEETGRSFKAGVLSENVL
FT                   VALSTLAGEPYSIAHEGRELVNNLTPHKATARDYTGLGSEVELDFHIENAAQAHMPEGD
FT                   TSPFALLLLGVRSEAGGGPYTRLADARRALQLLSPDDIAQLYGEHYIIRVPYRWRGAAP
FT                   TPRDNTDLSAVLSGPLDAPRVTVAFYPDMVLAVNTRAQEALANLYRAVREVSFGVQVSP
FT                   GKLVLINNHFTLHSRDRFDPQYDENDRAFRWVQRVFVARSLWNFRAFTPLQARVFDPKA
FT                   LYAGESVQARQPSPVVQPAPQRAAAVELEATPA"
FT                   /protein_id="YP_625358.1"
FT   misc_feature    complement(30545..>30871)
FT                   /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
FT                   trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
FT                   carrying out three reactions in the biosynthesis of
FT                   clavulanic acid, an inhibitor of class A serine
FT                   beta-lactamases. In general, Fe(II)-2OG...; Region:
FT                   CAS_like; cl00184"
FT                   /db_xref="CDD:174021"
FT                   /locus_tag="Bcen_5513"
FT   gene            31899..33350
FT                   /db_xref="GeneID:4096740"
FT                   /locus_tag="Bcen_5514"
FT   CDS_pept        31899..33350
FT                   /locus_tag="Bcen_5514"
FT                   /gene_family="HOG000239124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll5865 putative multidrug resistance protein"
FT                   /db_xref="GI:107028264"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096740"
FT                   /translation="MSDRAPTLDRIDRGDHMPTAAADSRRTSLRAIFPTVAAASLGFAI
FT                   VQLDVTVVNVAIPSLGHAFGSSIHGLQWIVDAYTLSFAALLLTSGTLADRFGSRRLFAY
FT                   GLALFLLASLGCALAPSLVTLVAARVAQGVGAAMILPTSLALITHACANDAAARVRAVA
FT                   WWSATGGAISAAGPTLGGLLIDSLGWRAIFFINLPICALGLWLTLRHVRDSAAARTRLF
FT                   DPAGQFVAVLVLGLLTGGIIRAGAHGLGDPYAAGALIASAVLGVLFVAIERRVAAPMLQ
FT                   LALFRLPRVPGVLAIGAVTNAAFYGLIFSLSVYFQNACGFTATESGLALAPLTIIMLAN
FT                   IASARLAVRYGFRATVIIGLAVSLAGYVWLWQTLAAHTPYLLLAPGLAAMAIGGGIAIP
FT                   ALTSTMLGSVEAGRSGTASAILNTARQVGAAIGVAALGALVAGQGAAIVAGAARAFVIA
FT                   AVLVAICVVLAVRWPRDASATGTRA"
FT                   /protein_id="YP_625359.1"
FT   misc_feature    32004..>32525
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5514"
FT   misc_feature    32010..33176
FT                   /note="drug resistance transporter, EmrB/QacA subfamily;
FT                   Region: efflux_EmrB; TIGR00711"
FT                   /db_xref="CDD:129794"
FT                   /locus_tag="Bcen_5514"
FT   misc_feature    order(32046..32048,32055..32063,32067..32072,32121..32123,
FT                   32130..32135,32142..32144,32154..32159,32163..32168,
FT                   32304..32309,32316..32321,32328..32333,32340..32342,
FT                   32376..32381,32388..32393,32409..32411)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5514"
FT   gene            33403..34671
FT                   /db_xref="GeneID:4096741"
FT                   /locus_tag="Bcen_5515"
FT   CDS_pept        33403..34671
FT                   /locus_tag="Bcen_5515"
FT                   /gene_family="HOG000266337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: ypm:YP3384 acetyl-CoA
FT                   carboxylase"
FT                   /db_xref="GI:107028265"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:4096741"
FT                   /translation="MQHRFIDTVLIVDGASTAAYLAPAFRAYGIRCAHVISDPDLPEIY
FT                   RNQFVPSDYIRQVQHRGDIDATLAQLSDLRIGAVLHGLDAALELADTLAERLDVPSRNP
FT                   LATSAARRDKFAMNERIRQAGLRAPAHFHSTSVDEALDWARAHGTLPLVVKPARSAGVA
FT                   GVKICRTLAQVEAAARDVLATRSLYNQPNDDIVIQSYSEGQEYIVDSVSFEGRHRVVSL
FT                   WEVHRDRTHAPRLDKMLVLNHADPRYAPLLDYAANVLDALDVRFGPTHLELFDTADGPT
FT                   IVELNARLHGSLDPRLTSAVSGENHVSAAVEAVLHPERLFGDVTAPTDFRGYCGHVLLL
FT                   SSRNGVLRQDFTWQAIQALPSFVGLKQWIKVGDTLRVTTDLQTALGTVGLYSPTFERLL
FT                   EDCRRIREIEADFFADEGAVAPA"
FT                   /protein_id="YP_625360.1"
FT   misc_feature    33424..34641
FT                   /note="hypothetical protein; Provisional; Region: PRK07206"
FT                   /db_xref="CDD:168858"
FT                   /locus_tag="Bcen_5515"
FT   misc_feature    33772..>34041
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen_5515"
FT   gene            complement(34680..35555)
FT                   /db_xref="GeneID:4096742"
FT                   /locus_tag="Bcen_5516"
FT   CDS_pept        complement(34680..35555)
FT                   /locus_tag="Bcen_5516"
FT                   /gene_family="HOG000233521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_C7214
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="GI:107028266"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096742"
FT                   /translation="MNIPLLETFRAVVQEGSALRAAERLGCTQSNVTARLRQLEESLDA
FT                   PLFDRHGKRLVLNDAGRRLIPYCDRILRLVDEATQVVRETPVARSFRLGSMESTAATRL
FT                   PALAAALKERDPALGLAVQIGSEPDLAEALLRGRIDAALTARAVVRPGLRYEPAFAEDM
FT                   VLVSAATVTRRQLLADNTVRLLAFHDGCPYRAVAEHWLKARGIAIESVSSFGTFGAILG
FT                   CVAAGMGVAILPKRITTEHVARKEVRTHAFDDLDSVTTYLVTPDEAPALPELDALRAVL
FT                   GRQAGALLAR"
FT                   /protein_id="YP_625361.1"
FT   misc_feature    complement(34683..35555)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_5516"
FT   misc_feature    complement(35370..35543)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5516"
FT   misc_feature    complement(34713..35288)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_5516"
FT   misc_feature    complement(order(34878..34883,34887..34892,34908..34925,
FT                   35184..35204,35208..35210,35220..35222,35229..35234,
FT                   35238..35243))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_5516"
FT   gene            35703..36647
FT                   /db_xref="GeneID:4096743"
FT                   /locus_tag="Bcen_5517"
FT   CDS_pept        35703..36647
FT                   /locus_tag="Bcen_5517"
FT                   /gene_family="HOG000266348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7215 hypothetical protein"
FT                   /db_xref="GI:107028267"
FT                   /db_xref="GeneID:4096743"
FT                   /translation="MRALIAALVRRGPTVLACGVGLGLLVPPLAALARPLMPVTVFVFV
FT                   LGTLLRVEPSAVRAVARRPAVSLLLPAMTMIACPVALGIAARLAGLPYDWVVALVIAYC
FT                   APPSSGTSTIARMLSLDASVALVATLASMVFVPLTAPLLTAWFSHDAAVSISPSSLALR
FT                   LALLIGSAEGVALLVRRFAGARLARHATPIDAVVVVALLIFALGTMAGMQQSIIDAPHR
FT                   ALTAIALAFVVNAGFQLVAYGLTPGDVRTRLNVALIVANRNVGLMWAALGLAATPTMTL
FT                   VFACAQLPIYTLPRVVQHLLPRLEAQRLRRRAR"
FT                   /protein_id="YP_625362.1"
FT   sig_peptide     35703..35804
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.945 at
FT                   residue 34"
FT                   /locus_tag="Bcen_5517"
FT                   /product="hypothetical protein"
FT   gene            36685..37896
FT                   /db_xref="GeneID:4096744"
FT                   /locus_tag="Bcen_5518"
FT   CDS_pept        36685..37896
FT                   /locus_tag="Bcen_5518"
FT                   /gene_family="HOG000266359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: mlo:mll9226
FT                   argininosuccinate lyase"
FT                   /db_xref="GI:107028268"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:4096744"
FT                   /translation="MKRLIVIGARATGSSVALVRAAVARRVAVTVITTPGHRLDGVFPD
FT                   DVETVNLTPDAGQLAGWLRARFPDELDTLRVTTAHDTYARTAAWVADALGLPGPDARHV
FT                   AYAVSKSNQKALLAEHGIPAAQFVAGTLAAPAALAAAAAPLRFPVVVKPSEGSASDGVR
FT                   RCEDIAAVRAQLDTLAAAAQADAPELATERVVIEEFLAGSEYCVEYFDGRYVGALRKLK
FT                   RHGAGFLERGYTSELDLDADTLRALIDVGTRATAAAGLTWGPVHLDCIVHDGVPHVIEL
FT                   NPRIAGSFICDIVRDGYGFNVVEALLDKLDGKAVTIPELFEPHAYARAEFLLDSDPGAW
FT                   RFARGGEIDDGAVRISYGPQVLPDRERRAFLYVRVALPAAHGAADDAGPAAERRELKST
FT                   TESA"
FT                   /protein_id="YP_625363.1"
FT   sig_peptide     36685..36750
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.878) with cleavage site probability 0.694 at
FT                   residue 22"
FT                   /locus_tag="Bcen_5518"
FT                   /product="hypothetical protein"
FT   misc_feature    36943..>37296
FT                   /note="phosphoribosylamine--glycine ligase; Provisional;
FT                   Region: PRK00885"
FT                   /db_xref="CDD:167091"
FT                   /locus_tag="Bcen_5518"
FT   misc_feature    37126..37548
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen_5518"
FT   misc_feature    <37471..>37665
FT                   /note="Predicted ATP-dependent carboligase related to
FT                   biotin carboxylase [General function prediction only];
FT                   Region: COG2232"
FT                   /db_xref="CDD:32413"
FT                   /locus_tag="Bcen_5518"
FT   gene            complement(37880..39076)
FT                   /db_xref="GeneID:4096745"
FT                   /locus_tag="Bcen_5519"
FT   CDS_pept        complement(37880..39076)
FT                   /locus_tag="Bcen_5519"
FT                   /gene_family="HOG000217197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A4820 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107028269"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096745"
FT                   /translation="MGNRTIRFAFFLCGFAAFLNLYSTQGILHELAAAFNVSAERAGQG
FT                   ISATTLAVAIIAPFVGALAARFDRRTVISWAAVACVLPVVWSAHAASFSSFLAARFAAG
FT                   MLMPFIFAISIACIGEIFSHDAATEVSALFVAGTTLGGFAGRFVTNVLTSGFGWRHALD
FT                   FIAFLCLATGLAIHACLPSSGAARPEGEGASIPRWKLLTRGPLLASFLVGACVLASQVA
FT                   TFTFVGLRLARAPFGFNTVEIGAIYAVFLVAVVVTPLAGRVAAKRGPRDLALAATGLAM
FT                   VGALLTLSGSVAAILTGLALSSTAVFVEQASANAFISRAAPGARSTAIGVYLSFYYFGG
FT                   SLGSILPVPAWNRWGWVGCVAFVVVAQAIAGALVFFFWRGTPPAGASKPRSPEVRLTR"
FT                   /protein_id="YP_625364.1"
FT   sig_peptide     complement(39005..39076)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.853) with cleavage site probability 0.600 at
FT                   residue 24"
FT                   /locus_tag="Bcen_5519"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(37943..39013)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5519"
FT   misc_feature    complement(order(38057..38059,38066..38071,38078..38083,
FT                   38090..38095,38123..38125,38132..38137,38147..38149,
FT                   38156..38161,38168..38170,38306..38308,38318..38320,
FT                   38336..38338,38348..38350,38393..38395,38402..38407,
FT                   38414..38419,38426..38428,38651..38653,38669..38674,
FT                   38681..38686,38720..38722,38729..38734,38741..38746,
FT                   38753..38758,38894..38899,38903..38908,38918..38920,
FT                   38927..38932,38939..38941,38990..38995,38999..39007))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5519"
FT   misc_feature    complement(37919..39001)
FT                   /note="Arabinose efflux permease [Carbohydrate transport
FT                   and metabolism]; Region: AraJ; COG2814"
FT                   /db_xref="CDD:32643"
FT                   /locus_tag="Bcen_5519"
FT   gene            39172..40062
FT                   /db_xref="GeneID:4096746"
FT                   /locus_tag="Bcen_5520"
FT   CDS_pept        39172..40062
FT                   /locus_tag="Bcen_5520"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_A4819
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="GI:107028270"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096746"
FT                   /translation="MLDLRRLRYFVTVAEELHFGRAALRLRIAQPPLTRHIAALEADLD
FT                   IRLFERSTRAVQLTPAGALFLEHARSVIHAVDEAEATARKMAQGMVGRVVIGYASSIPM
FT                   SDAFSDIIRNASRSMPEVELAFREVSTATQRQQIANGTMDVGFGWSAKAPGERIRSLVV
FT                   SRESLVAAVPARSKYADKATIEFRELVKENFVTFPAGYGSALNAALEDLCAQEGVTPRT
FT                   RPTASQITTLVSLVAAERGVAIVPGFTSTLQRSGVAYVPLARPHVLELVVTWSEPFSSS
FT                   CVEQFIEFARSITRG"
FT                   /protein_id="YP_625365.1"
FT   misc_feature    39175..40032
FT                   /note="DNA-binding transcriptional regulator HcaR;
FT                   Provisional; Region: PRK09906"
FT                   /db_xref="CDD:170151"
FT                   /locus_tag="Bcen_5520"
FT   misc_feature    39181..39357
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5520"
FT   misc_feature    39448..40041
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen_5520"
FT   misc_feature    order(39463..39465,39487..39489,39496..39501,39505..39510,
FT                   39517..39519,39541..39543,39547..39549,39553..39555,
FT                   39688..39690,39790..39795,39850..39855,39871..39876,
FT                   39880..39885,39937..39939)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen_5520"
FT   misc_feature    order(39466..39468,39616..39618,39760..39765,39784..39786)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen_5520"
FT   gene            complement(40129..40743)
FT                   /db_xref="GeneID:4096747"
FT                   /locus_tag="Bcen_5521"
FT   CDS_pept        complement(40129..40743)
FT                   /locus_tag="Bcen_5521"
FT                   /gene_family="HOG000266370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NIPSNAP; KEGG: bur:Bcep18194_B2743
FT                   hypothetical protein"
FT                   /db_xref="GI:107028271"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="GeneID:4096747"
FT                   /translation="MPYELTTLSCPLLDQDRVSRRAHHWVSDADAHGRLLGAWRTEIGE
FT                   LSRVVVLRGFETMDALQHERDRALRAERPFGIESASVRLTMESYALFPFLPDIEPAALG
FT                   DFYEIRRYWLKAGGIAPTISAWERAVGPAKAYTSHLVCNLYALDGPPRITHIWGFSSLE
FT                   ERMALRKRHYAEGLWPPAGGPEQIERATSTIGLPETWSPLR"
FT                   /protein_id="YP_625366.1"
FT   misc_feature    complement(<40537..>40659)
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="Bcen_5521"
FT   misc_feature    complement(40138..40425)
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="Bcen_5521"
FT   gene            40840..41760
FT                   /db_xref="GeneID:4096748"
FT                   /locus_tag="Bcen_5522"
FT   CDS_pept        40840..41760
FT                   /locus_tag="Bcen_5522"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pst:PSPTO2617 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:107028272"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096748"
FT                   /translation="MDLLKAMAVFVRIVETGSLTAAAQASDLSPTMVGNYLQTLESRLG
FT                   AVLVHRTTRKQKVSAFGHAYYERCVEILGLVDDTEQLALAHLKQPRGRLRVTAPVVFTN
FT                   ECLIPALADYYRRYPEIKLDIVATDSLADLFDEGFEAAIRIGTLANPDVVARPLAPYRL
FT                   VLCASPAYVHEHGAPATPHALGEHHCLTYAYPPRAEWHAAQTQWTLEGPDGPMSLSVDG
FT                   RLKIDNADALRRAALRGLGIAMLPSILIRDDIREKRLIEIMPDFAGPERTMNLLYLQER
FT                   QQSPKLRSFTEFVVDRFGAETACRT"
FT                   /protein_id="YP_625367.1"
FT   misc_feature    40849..41748
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_5522"
FT   misc_feature    40849..41028
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5522"
FT   misc_feature    41113..41721
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_5522"
FT   misc_feature    order(41161..41166,41170..41175,41182..41184,41194..41196,
FT                   41200..41220,41506..41523,41539..41544,41548..41553)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_5522"
FT   gene            complement(41944..42168)
FT                   /db_xref="GeneID:4096749"
FT                   /locus_tag="Bcen_5523"
FT   CDS_pept        complement(41944..42168)
FT                   /locus_tag="Bcen_5523"
FT                   /gene_family="HOG000218303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1150 hypothetical protein"
FT                   /db_xref="GI:107028273"
FT                   /db_xref="GeneID:4096749"
FT                   /translation="MHNKRIQQYNGYAVQPSAHRLPDGSFSSNLLLERADSTHDEGRYQ
FT                   FYSLDYFTSEAQALAHSARWARNWVDSRG"
FT                   /protein_id="YP_625368.1"
FT   gene            complement(42444..42647)
FT                   /db_xref="GeneID:4096750"
FT                   /locus_tag="Bcen_5524"
FT   CDS_pept        complement(42444..42647)
FT                   /locus_tag="Bcen_5524"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bur:Bcep18194_B1151 cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="GI:107028274"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="GeneID:4096750"
FT                   /translation="MDTGIVKWFNDSKGFGFITPDKGGDDLFAHFSEIRADGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPL"
FT                   /protein_id="YP_625369.1"
FT   misc_feature    complement(42450..42641)
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen_5524"
FT   misc_feature    complement(order(42477..42479,42564..42566,42597..42599,
FT                   42624..42626))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen_5524"
FT   misc_feature    complement(order(42558..42569,42588..42608))
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen_5524"
FT   gene            complement(42955..44058)
FT                   /db_xref="GeneID:4096751"
FT                   /locus_tag="Bcen_5525"
FT   CDS_pept        complement(42955..44058)
FT                   /locus_tag="Bcen_5525"
FT                   /gene_family="HOG000028073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr7894
FT                   putative epoxide hydrolase"
FT                   /db_xref="GI:107028275"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4096751"
FT                   /translation="MIHGVNGLDVHILEAGHESAGRPLALLLHGFPDLAYGWRHLMPIL
FT                   ADAGYHVVAPDQRGYGRTTGWANDYDAPLGPFSLLNMTRDALGLVSALGYRHTSMLVGH
FT                   DLGSPVAAYCALARPDVFPSVVLMSAPFPGPPALPFDTARSETSSAQPNSEGRKLAAAL
FT                   AALDPPRAYYQQYLCTRNANRDMWHPPQGLSAFLRAFFHVKSADWPGNKPHPLKALTAS
FT                   ELAQMPTYYVMDLGKTMPETVAPFQPSAAEILACKWLTDAELGVYTAEYGRTGFQGALQ
FT                   AYRVLSDPDLNAELRLFSGRTIDVPSLFIGGKRDWGTYSAPGALDLMRTKAATSMRGIE
FT                   LIDGAGHWIQQEQPGKLGELLLAFAKA"
FT                   /protein_id="YP_625370.1"
FT   misc_feature    complement(<43864..44010)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_5525"
FT   misc_feature    complement(<43660..43911)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_5525"
FT   misc_feature    complement(42958..>43290)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Bcen_5525"
FT   gene            44266..44895
FT                   /db_xref="GeneID:4096752"
FT                   /locus_tag="Bcen_5526"
FT   CDS_pept        44266..44895
FT                   /locus_tag="Bcen_5526"
FT                   /gene_family="HOG000161263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pae:PA0475
FT                   probable transcriptional regulator"
FT                   /db_xref="GI:107028276"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:4096752"
FT                   /translation="MAIAIDRSSGTWYFSRMTRKTDARARAIATAERLFRIQGYTATGL
FT                   TQILEESGAPKGSFYFHFPRGKAQLAEEAIDNYVTHRIAVLRNISADTTGHALNFVRQI
FT                   FSTFAAEMVATDFQYGCLMQNLANELPALDAELTQRVARGFADSTEVIAAHFRGCGFAA
FT                   ARASSAAAALVAALEGARTVARLERSPAVFDALADVSSQGWGASEG"
FT                   /protein_id="YP_625371.1"
FT   misc_feature    44311..>44694
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Bcen_5526"
FT   misc_feature    44347..44487
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Bcen_5526"
FT   gene            complement(45251..46171)
FT                   /db_xref="GeneID:4096542"
FT                   /locus_tag="Bcen_5527"
FT   CDS_pept        complement(45251..46171)
FT                   /locus_tag="Bcen_5527"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: ppu:PP2997 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:107028277"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096542"
FT                   /translation="MDNNATMPADLPDLKLLQLFDLLYDVRSVTRVAEQLGQSQPTVSI
FT                   WLGHLREHLHDPLFIRTPGGMAPTPQADALIGPCREILESLRRFTAWEIAFDPATAQRR
FT                   FRICMTDASHVTLLPRLLAHVRAQAPGVRLEAARIDGNTERALESGEADLAIGYVPWLG
FT                   GGIYQQKLYDQDWICLVNRHHPRIRGRLGARQYRSEGHVAITAGTGAQLLEQALRQARI
FT                   ERDVVLELPGFLGLGAIVQTTDLITTLPRHIGETLAQANDLAVHACPIPVEGFAVRQHW
FT                   HARYHHEAGNRWLRGVVIRLFGASH"
FT                   /protein_id="YP_625372.1"
FT   misc_feature    complement(45257..46093)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_5527"
FT   misc_feature    complement(45956..>46093)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5527"
FT   misc_feature    complement(45266..45862)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators that are involved in the
FT                   catabolism of dinitrotoluene, naphthalene and
FT                   gamma-hexachlorohexane; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_DntR_NahR_LinR_like; cd08459"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen_5527"
FT   misc_feature    complement(order(45341..45343,45542..45544,45650..45652,
FT                   45821..45823,45833..45838,45842..45844))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen_5527"
FT   misc_feature    complement(order(45404..45406,45446..45448,45455..45460,
FT                   45467..45472,45479..45493,45572..45574,45758..45760,
FT                   45764..45778,45782..45787,45794..45799,45803..45808,
FT                   45815..45820,45827..45832,45839..45841))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen_5527"
FT   gene            46253..47203
FT                   /db_xref="GeneID:4096543"
FT                   /locus_tag="Bcen_5528"
FT   CDS_pept        46253..47203
FT                   /locus_tag="Bcen_5528"
FT                   /gene_family="HOG000050222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: ppu:PP2998 2-dehydropantoate 2-reductase,
FT                   putative TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase-like;
FT                   Ketopantoate reductase ApbA/PanE-like"
FT                   /db_xref="GI:107028278"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="GeneID:4096543"
FT                   /translation="MKIAILGAGALGCAIGATLTEGGHETWLIDRSPAHVDAMRRDGLR
FT                   VDDARGTRQVRVHATTQAAEVGAADVVVVLVKSFHTDAAIRGALSLVGPDTVVLSLQNG
FT                   LGHEDILSDAVGRERVLAGKTYVGGVLRGPGHIESGVIGKNTYIGELDGRITPRVQAIA
FT                   AAFDTAGLATTISDNIVGTMWDKLLVNVATGALTGLTGLTYGQLYDEPLLKATSLAAVA
FT                   EAIAAAQAAGVKLSMTDPEQAWTLAAEGLPAAFKTSMLQSLEKGSITEIDFINGSVVRA
FT                   GQRHGVPTPVNATLVACIKGLERAMADRQREEAAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_625373.1"
FT   sig_peptide     46253..46315
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.444 at
FT                   residue 21"
FT                   /locus_tag="Bcen_5528"
FT                   /product="hypothetical protein"
FT   misc_feature    46313..47164
FT                   /note="2-dehydropantoate 2-reductase; Reviewed; Region:
FT                   PRK06522"
FT                   /db_xref="CDD:168592"
FT                   /locus_tag="Bcen_5528"
FT   misc_feature    46313..46711
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5528"
FT   misc_feature    46784..47161
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="Bcen_5528"
FT   gene            47200..47592
FT                   /db_xref="GeneID:4096544"
FT                   /locus_tag="Bcen_5529"
FT   CDS_pept        47200..47592
FT                   /locus_tag="Bcen_5529"
FT                   /gene_family="HOG000266381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ppu:PP2999 glyoxalase family
FT                   protein"
FT                   /db_xref="GI:107028279"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR011588"
FT                   /db_xref="GeneID:4096544"
FT                   /translation="MSATKAYLEHVAIWVKDIHWHIRFFEDVLGMTLREVDGPLDAPRQ
FT                   YWTLGGMQFIHAPDHNGPEGRLAHLGVMCEDLEAALAAARRFDVTEMPQGRNWIRLPDG
FT                   LAVELIQARPASCVAQALAINPRAEA"
FT                   /protein_id="YP_625374.1"
FT   misc_feature    47227..47526
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cd06587"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen_5529"
FT   misc_feature    order(47227..47229,47239..47241,47329..47331,47404..47406,
FT                   47515..47517,47521..47523)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen_5529"
FT   misc_feature    order(47227..47229,47404..47406,47521..47523)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen_5529"
FT   gene            47595..48053
FT                   /db_xref="GeneID:4096545"
FT                   /locus_tag="Bcen_5530"
FT   CDS_pept        47595..48053
FT                   /locus_tag="Bcen_5530"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MaoC-like dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC-like dehydratase; KEGG: ppu:PP3000 MaoC
FT                   domain protein"
FT                   /db_xref="GI:107028280"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="GeneID:4096545"
FT                   /translation="MTIVEKYWDDAREGDTCTSPTYLVTKERILAYADLTGDHTPVHVD
FT                   EEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVT
FT                   FRVGSMRASKSRPDWGIVVLPSELINQDGQVVQRGEHRLMVPRRPEAL"
FT                   /protein_id="YP_625375.1"
FT   misc_feature    47649..48026
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
FT                   Catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway.  The structure
FT                   of the monomer includes a five-strand antiparallel...;
FT                   Region: R_hydratase_like; cd03441"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen_5530"
FT   misc_feature    order(47691..47693,47706..47708,47712..47714,47721..47723,
FT                   47766..47768,47775..47780)
FT                   /note="active site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen_5530"
FT   misc_feature    order(47706..47708,47712..47714,47721..47723,47775..47777)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen_5530"
FT   gene            48053..49273
FT                   /db_xref="GeneID:4096546"
FT                   /locus_tag="Bcen_5531"
FT   CDS_pept        48053..49273
FT                   /locus_tag="Bcen_5531"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ppu:PP3001 CaiB/BaiF family protein"
FT                   /db_xref="GI:107028281"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:4096546"
FT                   /translation="MQARPLEGIRVVDYSHFLAGPYVGRCLAALGAEVIKVERPGAGDA
FT                   GRQHATVLDDQQSGYFLQLNMGKRGVSVNMKDARGKAFMQRLCDSADVFIENYRPGALD
FT                   KLGLGYEELSARNPGLVYCSISAYGHTGPDAHRAGFGLIAEAKSGIMQMVGTPGERPPL
FT                   LRISLGDMYTGIHAVAAINAALLGRVKSGRGQHVDMALYDTLVSMHEYAVQCYTLKGVL
FT                   PEQTGHDMPTSTLYGVFRAADGDLVIAAQVDDAWKRFAQLIEAHGGPAGFGADSRFHDS
FT                   TGRNAHRAAILSVVEPWVAARSVASVLDLLDGIDVPCAKVQRIDEVLNDPQIQARGMVV
FT                   EQQHPRYGTLRLPNLPFRFSDCDTTIREVAPDLGQHNAEVARSLGFDAAEIDAMQADGV
FT                   LYSKVSQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_625376.1"
FT   misc_feature    48059..49252
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:176929"
FT                   /locus_tag="Bcen_5531"
FT   misc_feature    48065..49270
FT                   /note="crotonobetainyl-CoA:carnitine CoA-transferase;
FT                   Provisional; Region: PRK03525"
FT                   /db_xref="CDD:167542"
FT                   /locus_tag="Bcen_5531"
FT   gene            49270..50106
FT                   /db_xref="GeneID:4096547"
FT                   /locus_tag="Bcen_5532"
FT   CDS_pept        49270..50106
FT                   /locus_tag="Bcen_5532"
FT                   /gene_family="HOG000237876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: bja:bll6392 shikimate 5-dehydrogenase TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate
FT                   binding-like"
FT                   /db_xref="GI:107028282"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="GeneID:4096547"
FT                   /translation="MMTDQYAVIGNPIGHTKSPLIHGLFAQETQQDLRYTAIEGPLEPA
FT                   GAFAATVRAFFDGGGKGINVTAPFKLDAFAMSDERSERAQLAGAANALKFDGGRILADN
FT                   FDGIGLVRDIEANLNLPMAGKRVLVLGAGGAARGALLPFLDAGPAELVIANRDVDKARL
FT                   LAAQVAGRGPLVAGSYADLARMGRFDLVVNATSASLTGDLPPVPPSVFSPTGTAYELAY
FT                   GKRLTPFLRLAKNAGVHGIADGVGMLVEQAAEAFAWWRGVRPATSAVIDRLAVPFD"
FT                   /transl_table="11"
FT                   /protein_id="YP_625377.1"
FT   misc_feature    49270..50088
FT                   /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
FT                   PRK00258"
FT                   /db_xref="CDD:166875"
FT                   /locus_tag="Bcen_5532"
FT   misc_feature    49291..49542
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="Bcen_5532"
FT   misc_feature    49585..50052
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_5532"
FT   misc_feature    order(49585..49587,49933..49935,50011..50013,50020..50022)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_5532"
FT   misc_feature    order(49663..49665,49672..49674,49732..49737,49849..49857,
FT                   49927..49929,49999..50001,50008..50013)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen_5532"
FT   gene            50284..51516
FT                   /db_xref="GeneID:4096548"
FT                   /locus_tag="Bcen_5533"
FT   CDS_pept        50284..51516
FT                   /locus_tag="Bcen_5533"
FT                   /gene_family="HOG000143170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eba:c2A195 possible transporter"
FT                   /db_xref="GI:107028283"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096548"
FT                   /translation="MPDTTRPARLNFALMLPLLLAAQPVATDSYLPALPEIAATLGSAS
FT                   VSLTVFALIFGVGQLPMGGLSDRIGRRPVLLTGLALYALSALAAALASSAAMLVAARAM
FT                   QGFAMAAILVCARATVRDRYSAGDGPYVMARGFMGMGMMAFLAPILGAYVTQHAGWRWV
FT                   LAGMSLYAFGLLVMCWYGFEESAARIAPGRNSTGDVREIFGNVPFRVWTLLAASTYTGM
FT                   FCFLLLSPTIYIRQLGISPQRYGWIPASGTLVYVLSTVGCRHLLRRQSMLRTVRQGATL
FT                   SLSGAVIQALGCALLPGSIWPLLVGHGVYCLGHGIHQPCGQAGAVSGLPHLAGRAVSWS
FT                   GFIMMFFAFSVGQTAAVFTDPRYQSGAWPMVVPMLGVGVTLVTIAFVWLPRIGGANLGA
FT                   AAVPARAVDGR"
FT                   /protein_id="YP_625378.1"
FT   sig_peptide     50284..50367
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.561 at
FT                   residue 28"
FT                   /locus_tag="Bcen_5533"
FT                   /product="hypothetical protein"
FT   misc_feature    50353..51429
FT                   /note="drug resistance transporter, Bcr/CflA subfamily;
FT                   Region: efflux_Bcr_CflA; TIGR00710"
FT                   /db_xref="CDD:162006"
FT                   /locus_tag="Bcen_5533"
FT   misc_feature    50359..51441
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5533"
FT   misc_feature    order(50362..50364,50371..50379,50383..50388,50425..50427,
FT                   50434..50439,50446..50448,50458..50463,50467..50472,
FT                   50608..50613,50620..50625,50632..50637,50644..50646,
FT                   50680..50685,50692..50697,50713..50715,50938..50940,
FT                   50947..50952,50959..50964,50971..50973,51013..51015,
FT                   51025..51027,51037..51039,51046..51048,51058..51060,
FT                   51214..51216,51223..51228,51235..51237,51247..51252,
FT                   51259..51261,51289..51294,51301..51306,51313..51318,
FT                   51325..51327)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5533"
FT   gene            complement(51630..52457)
FT                   /db_xref="GeneID:4096549"
FT                   /locus_tag="Bcen_5534"
FT   CDS_pept        complement(51630..52457)
FT                   /locus_tag="Bcen_5534"
FT                   /gene_family="HOG000266392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gvi:glr1296 unknown protein"
FT                   /db_xref="GI:107028284"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:4096549"
FT                   /translation="MTSYAEIYLKDFHRRRAGVTRRAYGNRPARSAQAAYPSSYHALAN
FT                   RVPNDAMSRTVLDLACGDGPLLQILNDRGHAATKLIGIDMSDGELSVARGILPHEIRLL
FT                   NERAQAMSLDSGSVDYVLSHMALMLMDDIEQVVREIRRVLCDGGSFSAIVGRSFLTGKV
FT                   GEVFLDIFKPIAKDRLTELRLGDARTRSEAGWQELLKPDFVDVSFEDIEIDWTPTPEQL
FT                   WLDMLDTYDADRMSEAARAQFKSELLSAFAPLQGEDGTLQTGWGLRLVQATAA"
FT                   /protein_id="YP_625379.1"
FT   misc_feature    complement(52008..52295)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen_5534"
FT   misc_feature    complement(order(52086..52088,52134..52142,52203..52208,
FT                   52263..52283))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen_5534"
FT   gene            complement(52744..53646)
FT                   /db_xref="GeneID:4096550"
FT                   /locus_tag="Bcen_5535"
FT   CDS_pept        complement(52744..53646)
FT                   /locus_tag="Bcen_5535"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   reu:Reut_C5900 NADP oxidoreductase, coenzyme
FT                   F420-dependent:6-phosphogluconate dehydrogenase,
FT                   NAD-binding:3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="GI:107028285"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="GeneID:4096550"
FT                   /translation="MKQQIGLIGVGLMGHGIARNVLKHGYPLTVVEHPGNQPLDELLRD
FT                   GVRTVRTARELAAQADVIILCVTGSPEVEAVLTGDDGVLAGLRDNAIVVDCSTAVPEST
FT                   VRMARLVEAAGGRFVDAPMTRGAKEAHEGRLNLLVGAPPGLFAEIRPVLACFAENITCV
FT                   GDVGAGHSMKLLHNYVSLGTIALLSEAVACAKRSGVDVAVLADVLANGGGGGAALNRLR
FT                   PFLETGDTSALPFHMANALKDLSYYSAMAEGVDAAHGIAAAVTETYRDAVAGAGAHCPV
FT                   LKLSDVLMVGGVGDEGTSR"
FT                   /protein_id="YP_625380.1"
FT   misc_feature    complement(52828..53637)
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Bcen_5535"
FT   misc_feature    complement(<53116..53637)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5535"
FT   gene            complement(53704..55032)
FT                   /db_xref="GeneID:4096551"
FT                   /locus_tag="Bcen_5536"
FT   CDS_pept        complement(53704..55032)
FT                   /locus_tag="Bcen_5536"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_A2617 general substrate transporter:major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="GI:107028286"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096551"
FT                   /translation="MEIDAACNPGDLAAPASAHDLAQEDRIFRRLAVQILPILMFAYVT
FT                   SYIDRVNVSFAKLQMSEHLGFSDAVFGFGAGIFFLGYVIFEVPSNMLLVRVGPRRWITR
FT                   IVVSWGVVSGLTAFVSTPMQFYVMRFLLGVAEAGFIPAIVLYMARSFPGRRRARILSMF
FT                   YAALALAGLIGSPLTGFILQYFDGAMQIPGWKWIFILESLPAFVAALYVWKGLDDDVTR
FT                   SERFSQAERAVLARVLAEDRATTESVNHRGLFSNWLVWAFCVIYFLDVFAIYGYTFWAP
FT                   TMIKQMGIGSDFVIGLLAALPNAVAVVVMVLFGRSADRCGRQRLHVAALLLMGATGLGL
FT                   SVVWHDQLWLGMFALCIANAGLISFPPLFWSMPTAALGTASVSMGIAVISSFGNLGGFF
FT                   GPYAVGYLKQASGSLAAPLFVMVGCLLLGIVLTMLLPARLVDR"
FT                   /protein_id="YP_625381.1"
FT   misc_feature    complement(53752..54960)
FT                   /note="4-hydroxyphenylacetate permease; Region: HpaX;
FT                   TIGR02332"
FT                   /db_xref="CDD:131385"
FT                   /locus_tag="Bcen_5536"
FT   misc_feature    complement(53725..54927)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5536"
FT   misc_feature    complement(order(53842..53844,53851..53856,53863..53868,
FT                   53875..53880,53911..53913,53920..53925,53935..53937,
FT                   53944..53949,53956..53958,54103..54105,54115..54117,
FT                   54124..54126,54136..54138,54148..54150,54190..54192,
FT                   54199..54204,54211..54216,54223..54225,54520..54522,
FT                   54538..54543,54550..54555,54589..54591,54598..54603,
FT                   54610..54615,54622..54627,54763..54768,54772..54777,
FT                   54787..54789,54796..54801,54808..54810,54859..54864,
FT                   54868..54876,54883..54885))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5536"
FT   gene            55428..56348
FT                   /db_xref="GeneID:4096552"
FT                   /locus_tag="Bcen_5537"
FT   CDS_pept        55428..56348
FT                   /locus_tag="Bcen_5537"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pfl:PFL_3650 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:107028287"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096552"
FT                   /translation="MFDLTSLALFVRAAELGSLSRAAQQSHMSLSTASRRIALLEHHFR
FT                   VVLLNRTVAGVELTPAGEALLRHATDLLLRTDAIYSELSDYTKGAVGRVRVFANISAIS
FT                   QDLPDQLRTFSQRYRDIKLQISELRSSDILQALREGRADVGIVTSRTAPEGIHLAPYCM
FT                   DRASVVVPDDYPLTGDSIDFSALLDHDLVALDDRSELTRALVREAALLGKSVRFRVQVQ
FT                   SFEAMCRLIAAGQGIGILPERAVALFREPMRLRFIRLNDPWANRVMSVGIRAGAVPLPT
FT                   RKLFEFLASFAPPSLVSGEAGQSND"
FT                   /protein_id="YP_625382.1"
FT   misc_feature    55431..56303
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen_5537"
FT   misc_feature    55437..55616
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5537"
FT   misc_feature    55704..56291
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_5537"
FT   misc_feature    order(55749..55754,55758..55763,55770..55772,55782..55784,
FT                   55788..55808,56079..56096,56112..56117,56121..56126)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_5537"
FT   gene            56651..57754
FT                   /db_xref="GeneID:4096553"
FT                   /locus_tag="Bcen_5538"
FT   CDS_pept        56651..57754
FT                   /locus_tag="Bcen_5538"
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="KEGG: pfl:PFL_3649 tartrate dehydrogenase TIGRFAM:
FT                   Tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="GI:107028288"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="GeneID:4096553"
FT                   /translation="MKNPHRIAVIAGDGIGKEVMPEGLRVLRAAAARFDIPLAFDEFGD
FT                   WCTDHYVRHGTMMPADWARQIGAHDAIFFGAVGAPDIVPDHVAVWESLIKIRREFDQYV
FT                   NLRPVRLMPGVPAPLAGRQPGDIDFIVVRENTEGEYSSVGGRMFTGTDREIAVQQSVFS
FT                   RVGVDRVLRFAFELARSRPRKQLTAATKSNGISITMPFWDERLAEMARSFPDIETRKYH
FT                   IDILCAHFVQNPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERRFPSLFEP
FT                   VHGSAPDIAGRGIANPIGQIWSAALLLQHLGRGESRYEAAAAEIVAAIESVLIAGPRTR
FT                   DMGGTASTEELGAAIAHTIANPASIEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_625383.1"
FT   misc_feature    56651..57727
FT                   /note="Isocitrate/isopropylmalate dehydrogenase; Region:
FT                   Iso_dh; cl00445"
FT                   /db_xref="CDD:174206"
FT                   /locus_tag="Bcen_5538"
FT   gene            57758..59206
FT                   /db_xref="GeneID:4096554"
FT                   /locus_tag="Bcen_5539"
FT   CDS_pept        57758..59206
FT                   /locus_tag="Bcen_5539"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: pfl:PFL_3648
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="GI:107028289"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4096554"
FT                   /translation="MQFDHYIGNARVVPNTGERIDVVDPSTGEPFATIARGDATDVQRA
FT                   VSAAQRAMGDTLDGPWAKLSPVERSNLLFAYAAAVSQHADELAQLEARDTGKALNTART
FT                   DAAVLARYLQYYAGCVDKLHGDTLPYTAGFTVLTVREPIGVTGHIIPWNYPMQIYGRSV
FT                   GASLAAGNACVVKPAEDASLSILRLAEIAAEVGFPAGTVNVVTGLGGEAGAALSAHPGI
FT                   RHISFTGSTGTGALVGRAAAERHCPAVLELGGKSPQLLFDDADLDQALPVIVNAIVQNA
FT                   GQTCSAGSRLLVQRTVYERVLDRLAQQFERLRSGPPSMNLEMGPLVNAKQHARVRAIVE
FT                   RAQADGIRVAARGTIAAGASGAGYYQEAVLFRDVPPDSELAQEEVFGPVLAAMPFDDED
FT                   AAVALANGTQYGLVAGVWTRDGARALRLARKLQAGQVFINNYGAGGGVELPFGGVKASG
FT                   YGREKGFEALLGFTALKTIAIRHD"
FT                   /transl_table="11"
FT                   /protein_id="YP_625384.1"
FT   misc_feature    57764..59191
FT                   /note="1-pyrroline-5-carboxylate dehydrogenase;
FT                   Provisional; Region: PRK03137"
FT                   /db_xref="CDD:167499"
FT                   /locus_tag="Bcen_5539"
FT   misc_feature    57821..59194
FT                   /note="Uncharacterized Saccharopolyspora spinosa aldehyde
FT                   dehydrogenase (AAS00426)-like; Region: ALDH_AAS00426;
FT                   cd07109"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen_5539"
FT   misc_feature    order(58202..58216,58238..58240,58283..58285,58289..58294,
FT                   58436..58447,58454..58456,58463..58468,58508..58516,
FT                   58610..58612,58907..58909,58913..58915,58991..58993,
FT                   59108..59110)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen_5539"
FT   misc_feature    order(58214..58216,58508..58510,58601..58603,58610..58612)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen_5539"
FT   misc_feature    order(58508..58510,58601..58603,58610..58612)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen_5539"
FT   gene            complement(59486..60424)
FT                   /db_xref="GeneID:4096555"
FT                   /locus_tag="Bcen_5540"
FT   CDS_pept        complement(59486..60424)
FT                   /locus_tag="Bcen_5540"
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: pca:Pcar_2430 cysteine synthase A"
FT                   /db_xref="GI:107028290"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="GeneID:4096555"
FT                   /translation="MKSTPGSILDTIGNTSLVPLRHVVPKNGARLFVKLESQNPTGSMK
FT                   DRIALAMIEAPERDGRLKPGGAVVEYTGGSTGVSLALVCAVKRHPLHLVSSDAFSKEKL
FT                   DHMRLLGAELTLVPSDNGKQTGKLTKDMIREAHRIAGETGAYITAQMENTDQLDAYTKM
FT                   ADEIWEQTGGRLDGFVQSVGTAASLRGISRRLREHDARIRIAGVEPAESAVLSGGSTGA
FT                   HKIDGIGAGYVVPLWRDGIADELERVSTEDARAMAFRLAAEEGLFCGTSTGANVTGALR
FT                   LAERLGPDATIVTIMCDTGMKYLKSFAQTMG"
FT                   /transl_table="11"
FT                   /protein_id="YP_625385.1"
FT   misc_feature    complement(59513..60406)
FT                   /note="Cysteine synthase [Amino acid transport and
FT                   metabolism]; Region: CysK; COG0031"
FT                   /db_xref="CDD:30381"
FT                   /locus_tag="Bcen_5540"
FT   misc_feature    complement(59513..60388)
FT                   /note="CBS_like: This subgroup includes Cystathionine
FT                   beta-synthase (CBS) and Cysteine synthase. CBS is a unique
FT                   heme-containing enzyme that catalyzes a pyridoxal
FT                   5'-phosphate (PLP)-dependent condensation of serine and
FT                   homocysteine to give cystathionine...; Region: CBS_like;
FT                   cd01561"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen_5540"
FT   misc_feature    complement(order(59513..59515,59522..59524,59552..59554,
FT                   59624..59632,59636..59644,59915..59920,60095..60100,
FT                   60107..60112,60119..60124,60170..60172,60179..60181,
FT                   60305..60307,60311..60313,60329..60331,60368..60376))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen_5540"
FT   misc_feature    complement(order(59531..59536,59612..59614,59744..59746,
FT                   59864..59881,60200..60202,60290..60292))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen_5540"
FT   misc_feature    complement(60290..60292)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen_5540"
FT   gene            complement(60471..60878)
FT                   /db_xref="GeneID:4096556"
FT                   /locus_tag="Bcen_5541"
FT   CDS_pept        complement(60471..60878)
FT                   /locus_tag="Bcen_5541"
FT                   /gene_family="HOG000168796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG)"
FT                   /transl_table="11"
FT                   /note="PFAM: membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG); KEGG: bja:bll4359
FT                   hypothetical protein"
FT                   /db_xref="GI:107028291"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="GeneID:4096556"
FT                   /translation="MTFSPELHLLTLTAIATLLMWIPYMLARIMTRGLMAALSNPDPSH
FT                   PPDPPWAERARRAHANAIENLAVFAPLVLMCAMTGASSPATVFSARLYLGARLVHYVVY
FT                   AAGIPVVRTIAFLTGFAATLTFAVALLGHAT"
FT                   /protein_id="YP_625386.1"
FT   misc_feature    complement(60537..>60728)
FT                   /note="MAPEG family; Region: MAPEG; cl09190"
FT                   /db_xref="CDD:158449"
FT                   /locus_tag="Bcen_5541"
FT   gene            complement(61101..61967)
FT                   /db_xref="GeneID:4096557"
FT                   /locus_tag="Bcen_5542"
FT   CDS_pept        complement(61101..61967)
FT                   /locus_tag="Bcen_5542"
FT                   /gene_family="HOG000221953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NmrA-like"
FT                   /transl_table="11"
FT                   /note="PFAM: NmrA-like; KEGG: mlo:mlr7972 hypothetical
FT                   protein"
FT                   /db_xref="GI:107028292"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="GeneID:4096557"
FT                   /translation="MYAITGITGKVGGALARELLASGRPVRAVVRDATRAAAWAARGCE
FT                   IATAFMEAPALLADAFAGATGVFILLPPVFDPAPGFPEARKVIEAVSAALLKARPDRVV
FT                   CLSTIGAQADEPNLLTQLALMEQALREMPMPVTFLRPGWFMENAAWDVASARDEGVVAS
FT                   YLQPLDKPVPMVATADVGRVAAQLLQQTWHGVRVVELEGPCRVSPNDLALAFARVLGRD
FT                   VRAEAVDRRTWEALFRAQGMKHPLPRMRMLDGFNEGWIDFESDPEEILHGHVALDTVLG
FT                   ELVSRTV"
FT                   /protein_id="YP_625387.1"
FT   misc_feature    complement(61110..61967)
FT                   /note="Predicted nucleoside-diphosphate-sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG0702"
FT                   /db_xref="CDD:31046"
FT                   /locus_tag="Bcen_5542"
FT   misc_feature    complement(61275..>61769)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5542"
FT   gene            62076..63098
FT                   /db_xref="GeneID:4096558"
FT                   /locus_tag="Bcen_5543"
FT   CDS_pept        62076..63098
FT                   /locus_tag="Bcen_5543"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_A5810
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="GI:107028293"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096558"
FT                   /translation="MIDTDARRGYAVRRRRVGLQWVVRDPPPVFSRTTMRSSSEKLSGS
FT                   ISVFAAVVDAGTFSAAADVIGMTPPGVSRAIARLEKRLNIRLFNRTTRSVSLTEEGRRF
FT                   YEQVMPHLAGLEEAAAAAAGGASAVRGKLRINLDPVVYRAILGPRLDAFMDAHPELEIE
FT                   LIARDSLGDLVMDGFDLAVRFGEPRASSLIARKLLDTGVVTVAAPSYIARRGRPAKPED
FT                   LEDRHHRCLEFRNPETGKPFAWEFHRKRKRIVVDTRGRLTVNDPGALLNACLAGSGIAQ
FT                   MLLLGAEPLIADGRLINLFPEWADERYPLYAYYPSRHHVPAKTRAFLDFIRICSEKPRH
FT                   "
FT                   /protein_id="YP_625388.1"
FT   misc_feature    62208..63068
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen_5543"
FT   misc_feature    62217..62381
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5543"
FT   misc_feature    62466..63068
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5543"
FT   misc_feature    order(62496..62498,62508..62510,62625..62627,62667..62669,
FT                   62673..62675,62871..62873,62922..62924,63003..63005)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5543"
FT   misc_feature    order(62499..62504,62514..62519,62523..62528,62535..62537,
FT                   62547..62549,62553..62573,62760..62762,62853..62867,
FT                   62886..62891,62898..62900)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5543"
FT   gene            63160..64212
FT                   /db_xref="GeneID:4096559"
FT                   /locus_tag="Bcen_5544"
FT   CDS_pept        63160..64212
FT                   /locus_tag="Bcen_5544"
FT                   /gene_family="HOG000125069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS605 OrfB"
FT                   /transl_table="11"
FT                   /note="PFAM: putative transposase, IS891/IS1136/IS1341;
FT                   transposase, IS605 OrfB; KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="GI:107028294"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="GeneID:4096559"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWSKKWP
FT                   TGFNLNVLATGSSKELGIHSGTVNATCEQYAKSRSQRRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGTNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDQFGRRAAEKLAKAQRARKHKRHIAKLHAKVANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAVKLARTRMAKSVYDASWSSFRNKLRYKAVAHGATF
FT                   EEVDESGSTQSCSSCGSKDSSTRPKGIAGLRVREWACSDCGAEHDRDINAALNILRCGR
FT                   ASPGVGIRRL"
FT                   /protein_id="YP_625389.1"
FT   misc_feature    <63580..63891
FT                   /note="Probable transposase; Region: Transposase_2;
FT                   pfam01385"
FT                   /db_xref="CDD:144832"
FT                   /locus_tag="Bcen_5544"
FT   misc_feature    63946..64170
FT                   /note="Putative transposase DNA-binding domain; Region:
FT                   Transposase_35; pfam07282"
FT                   /db_xref="CDD:115907"
FT                   /locus_tag="Bcen_5544"
FT   gene            complement(64282..65244)
FT                   /db_xref="GeneID:4096560"
FT                   /locus_tag="Bcen_5545"
FT   CDS_pept        complement(64282..65244)
FT                   /locus_tag="Bcen_5545"
FT                   /gene_family="HOG000063198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI; SMART: Helix-turn-helix, AraC type;
FT                   KEGG: nmu:Nmul_A0916 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="GI:107028295"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:4096560"
FT                   /translation="MRLTILALEGLFDTGLTVLLDTFAMANELAAAQGFAAPPFDVTVA
FT                   GVRKRVRTAHGLSMLVEPASSVRRPDWVAVPAPGIREPERLIETLQRRDVCDAMAHLRA
FT                   WHADGVGVAAACIGTFLLAEAGLLDHREATTTWSLSPFFRQRYPAVDLNDSRMVVAADR
FT                   VVTAGSAMGHLDLALWLLRQASPELATLVARFMLIDKRSSQAEYIIPDYLAHADPLIAR
FT                   FERWAREHLSLGFSLQTAAAALAVGPRTLQRRTEAVLGKSPLAFFQDLRIERAQNLVSM
FT                   GYDLETIASEVGYADSATLRALLRRRLGRGVRELRADNR"
FT                   /protein_id="YP_625390.1"
FT   misc_feature    complement(64648..65238)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_2; cd03138"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bcen_5545"
FT   misc_feature    complement(64897..64899)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bcen_5545"
FT   misc_feature    complement(<64351..64644)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bcen_5545"
FT   gene            65397..66320
FT                   /db_xref="GeneID:4096561"
FT                   /locus_tag="Bcen_5546"
FT   CDS_pept        65397..66320
FT                   /locus_tag="Bcen_5546"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: mlo:mll1982
FT                   probable short chain oxidoreductase"
FT                   /db_xref="GI:107028296"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4096561"
FT                   /translation="MRLRSSNLIGWETLNMSRTILITGASSGFGRDTAETLSRAGHRVF
FT                   ASMRDVAGRNRPHADALRASGVQVVELDVTDDASVERGVASVLEHAGRLDVLINNAGIG
FT                   SAGVSEAFTTKQVQALFDVNVFGIQRMSRAVLPTFRKQGEGLIVNVGSILGRVTFPFFG
FT                   LYGASKFAIEALTDSYRYELSTLGIDVVLVQPSNYPTNIFGSAQRPADAARVPGYGEAG
FT                   AIPDKMVETLMTLFASDHAPDPHDVAEAIAQLVEQAPGTRPARWVVGQSFGADALNAQA
FT                   AAIQAQTLESLGLAHLAGPQGQSAAA"
FT                   /protein_id="YP_625391.1"
FT   misc_feature    65436..66206
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Bcen_5546"
FT   misc_feature    65445..66185
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5546"
FT   gene            complement(66488..67228)
FT                   /db_xref="GeneID:4097330"
FT                   /locus_tag="Bcen_5547"
FT   CDS_pept        complement(66488..67228)
FT                   /locus_tag="Bcen_5547"
FT                   /gene_family="HOG000273993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR-like; KEGG:
FT                   pae:PA5525 probable transcriptional regulator"
FT                   /db_xref="GI:107028297"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:4097330"
FT                   /translation="MSHDIEPTTTQQDTIYATLRQWVTVGRFLPGERLKIRNVAAEMGV
FT                   GQMPVRAALQRLAAEGALVNVPNAGTIVPRLTVPEFDDLLQMRMLLEGEAAERGCLRLE
FT                   PAELATLRKLCQRMAKALKHPADQPARARKSAGDKPTLKQPAVSLKADQATDYLAANED
FT                   FHVLLYKAAGSPLLFELIDTLWLKAGPISNRLFDTSEASAVLNDAHEDLMDALDRRDAA
FT                   AARRAVERDIFVAGQFLRSTLKRD"
FT                   /protein_id="YP_625392.1"
FT   misc_feature    complement(67010..67186)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_5547"
FT   misc_feature    complement(order(67016..67027,67031..67036,67064..67066,
FT                   67073..67078,67082..67096,67118..67123))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_5547"
FT   misc_feature    complement(66599..66982)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Bcen_5547"
FT   gene            complement(67225..68607)
FT                   /db_xref="GeneID:4097331"
FT                   /locus_tag="Bcen_5548"
FT   CDS_pept        complement(67225..68607)
FT                   /locus_tag="Bcen_5548"
FT                   /gene_family="HOG000020210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="GI:107028298"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:4097331"
FT                   /translation="MNHTLPHTGIEHERVQALLAHERAEYAQRNPKSQVMSARAAPQLM
FT                   FGVPLHWMNDWSTPFALHVAQAQGAQLTDVDGHTLADFCLGDTGAMFGHSPAVVTEALA
FT                   TQARQGLTTMLPNEDASVVGELLARHFGLPKWQFAMTASDANRFLLRWVRAATGRRTLL
FT                   VFNGCYHGTVDDVFVDLVDGQPTQRASLLGQVHDLTITTRVVEFNDLAALEAALAPGDV
FT                   ACVLAEPVMTNIGMVLPEPGYWAQAQDLIRRHGSLLVLDETHTLSSGPGGYACAHGLQP
FT                   DAVVVGKALGGGMPCAAYGFSAALAERAEAAKRTAPPGHSGIGTTLTANLLAMAAMRAT
FT                   LTHLMTPEVFAPMHALAEQLAAGLRTIIARHGLPWCVTQVGARVEFQFCPQPPRNGSQA
FT                   EAVMDAELEHALHLALLNRGVLITPFHNMMLVCPDTTRMHVQRLLAAFDTVLASLTAAA
FT                   DS"
FT                   /protein_id="YP_625393.1"
FT   misc_feature    complement(67240..68592)
FT                   /note="aminotransferase; Validated; Region: PRK07046"
FT                   /db_xref="CDD:168782"
FT                   /locus_tag="Bcen_5548"
FT   misc_feature    complement(67255..68463)
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Bcen_5548"
FT   misc_feature    complement(order(67744..67749,67816..67818,67825..67827,
FT                   67924..67926,68170..68172,68179..68184))
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen_5548"
FT   misc_feature    complement(67744..67746)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen_5548"
FT   gene            complement(68618..69952)
FT                   /db_xref="GeneID:4097332"
FT                   /locus_tag="Bcen_5549"
FT   CDS_pept        complement(68618..69952)
FT                   /locus_tag="Bcen_5549"
FT                   /gene_family="HOG000005154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   glnA; glutamine synthetase family protein"
FT                   /db_xref="GI:107028299"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="GeneID:4097332"
FT                   /translation="MNDALSDFLTRHRIREVECVIPDMTGIARGKILPRDLFTASGEMR
FT                   IPKSVLLNTVNGQQPDNSPFVGDTDPDMVCKPDAATVRIVPWAAEPVAVVIHDCLEWDG
FT                   QPVQLSPRAVLRRVLALYEARGWQPVVAPEMEFYLVARNQNPHEPLQPPLGRTGKPEVG
FT                   RQSYSIDAVNDFDPFFMELSAFCDQHQLGVETLIHEAGPGQMEINFSHGEPLDLADRVF
FT                   LFKRTVRETALRHGVFATFMAKPMEGEPGSAMHIHQSINDGEGRNIFSNTDGTASEHFH
FT                   HFIGGLQTYIPQVMPMLAPYVNSYRRLAPYMSAPINVRWGQGNRTCGIRVPKSGPGARR
FT                   VENRVPGVDANPYLAMAATLACGYIGMRDRLHPSEPTEGSAWNVAHELPRHLENAIEAM
FT                   RACDAMKEVLGETFVDAFCAVKELEFSTYNRVISSWEREHLLLLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_625394.1"
FT   misc_feature    complement(68624..69946)
FT                   /note="Glutamine synthetase [Amino acid transport and
FT                   metabolism]; Region: GlnA; COG0174"
FT                   /db_xref="CDD:30523"
FT                   /locus_tag="Bcen_5549"
FT   misc_feature    complement(68864..69625)
FT                   /note="Glutamine synthetase, catalytic domain; Region:
FT                   Gln-synt_C; pfam00120"
FT                   /db_xref="CDD:143894"
FT                   /locus_tag="Bcen_5549"
FT   gene            complement(70034..70381)
FT                   /db_xref="GeneID:4097333"
FT                   /locus_tag="Bcen_5550"
FT   CDS_pept        complement(70034..70381)
FT                   /locus_tag="Bcen_5550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028300"
FT                   /db_xref="GeneID:4097333"
FT                   /translation="MCVVAVPPTVLGGEAAGGSTGGCRPEAAGSSISETDGQTTAPLGN
FT                   PTVGPFPDLGLGNQWPIKSNGRLCIQTGHLLFDAENGWRGSVSTTVPKGCSWTCDRRCS
FT                   RCRELSCSSLG"
FT                   /protein_id="YP_625395.1"
FT   gene            complement(70453..71217)
FT                   /db_xref="GeneID:4097334"
FT                   /locus_tag="Bcen_5551"
FT   CDS_pept        complement(70453..71217)
FT                   /locus_tag="Bcen_5551"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   reu:Reut_B3691 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:107028301"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4097334"
FT                   /translation="MARKLDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRQAELD
FT                   AAVAGIREAGGTATGVRSDSTKLDELDALYAQIKEEQGRLDVLFVNAGGGSMLPLGSIT
FT                   EAHYDDTFDRNVKGVLFTVQKALPLLADGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FARSWILDLKDRRIRVNTISPGATRTPGLLDLAGDDAGQRQGLADYLAAQIPMGRLGEP
FT                   GEIAGAALFLASDDASFVNGIELFVDGGQQQI"
FT                   /protein_id="YP_625396.1"
FT   misc_feature    complement(70468..71217)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5551"
FT   sig_peptide     complement(71131..71217)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.941 at
FT                   residue 29"
FT                   /locus_tag="Bcen_5551"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(70465..71208)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Bcen_5551"
FT   gene            71359..72276
FT                   /db_xref="GeneID:4097335"
FT                   /locus_tag="Bcen_5552"
FT   CDS_pept        71359..72276
FT                   /locus_tag="Bcen_5552"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: reu:Reut_B3692 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="GI:107028302"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4097335"
FT                   /translation="MAHLPDFEGLAMFAKVAEHGSFAAAARSTGVSVATVSRGVARLED
FT                   RLGARLFNRTSRQLSLTEFGRTISEKAGEIYRQAEEAESSAREMSVQPRGLVRLAVPMS
FT                   FGLRWVAPLLPGFFRAYPEVSIDLHLSDASVDLIADGFDAALRIAALPDSSLVARRLCA
FT                   VTQFVVAAPEYLRREGRPTHPLELADRPCLPYAYRARSAVWRFTNDAGDEESVMPTGPL
FT                   RVTNADALLPTLLDGLAIAELPEFIAGEYLADGRLEAILPDWSLTTGGLYFVTPSARAR
FT                   PAKVTALSDYFAEHLGNPVWRWPK"
FT                   /protein_id="YP_625397.1"
FT   misc_feature    71377..71556
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5552"
FT   misc_feature    71380..72240
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen_5552"
FT   misc_feature    71641..72231
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5552"
FT   misc_feature    order(71671..71673,71683..71685,71800..71802,71842..71844,
FT                   71848..71850,72037..72039,72088..72090,72169..72171)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5552"
FT   misc_feature    order(71674..71679,71689..71694,71698..71703,71710..71712,
FT                   71722..71724,71728..71748,71929..71931,72019..72033,
FT                   72052..72057,72064..72066)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen_5552"
FT   gene            complement(72412..72756)
FT                   /db_xref="GeneID:4097336"
FT                   /locus_tag="Bcen_5553"
FT   CDS_pept        complement(72412..72756)
FT                   /locus_tag="Bcen_5553"
FT                   /gene_family="HOG000266403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulatory protein, LysR"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_A1130 regulatory protein, LysR:LysR,
FT                   substrate-binding"
FT                   /db_xref="GI:107028303"
FT                   /db_xref="GeneID:4097336"
FT                   /translation="MGRHIQLVVTDNQPDAGKTQQGVASERQWWVDDLGAKHDLLRGSL
FT                   CWGRMPRHMVDADLAKGTLVELQRRAWHMRPLTFMVSQRRGYAFSGCETRLVELLGQCP
FT                   SHRVRRGKST"
FT                   /protein_id="YP_625398.1"
FT   misc_feature    complement(72526..>72642)
FT                   /note="transcriptional regulator, ArgP family; Region:
FT                   argP; TIGR03298"
FT                   /db_xref="CDD:163206"
FT                   /locus_tag="Bcen_5553"
FT   gene            complement(72814..73551)
FT                   /db_xref="GeneID:4097337"
FT                   /locus_tag="Bcen_5554"
FT   CDS_pept        complement(72814..73551)
FT                   /locus_tag="Bcen_5554"
FT                   /gene_family="HOG000243724" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bur:Bcep18194_A4481 ABC chain amino acid
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="GI:107028304"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4097337"
FT                   /translation="MKVTIAYIEEPPFGWTEADGTARGADLELAATILRQIGVTRVEYC
FT                   PTTFSELLPGVASGHWDMNVPLFVTPQRAHTVAFSVPVWGIEDGFLVRPGNPKALRRYA
FT                   SIAERPDARLGIIAGQVQHDSAMAAGVSRRQIVVFEQQADAIAAVLSGVIDAYASTALG
FT                   NRIVAGRIGSAMIEAVAHEPDGDGSQRTPPLGAFSFNRENRDLLTAFNRQLRAYVGSPD
FT                   HRARMARFGLTDREIDPAVSPTG"
FT                   /protein_id="YP_625399.1"
FT   misc_feature    complement(72901..73548)
FT                   /note="Bacterial periplasmic substrate-binding proteins;
FT                   Region: PBPb; smart00062"
FT                   /db_xref="CDD:128376"
FT                   /locus_tag="Bcen_5554"
FT   misc_feature    complement(72904..73521)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5554"
FT   misc_feature    complement(order(73072..73074,73189..73191,73333..73335,
FT                   73405..73407))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5554"
FT   misc_feature    complement(order(73093..73095,73111..73113,73123..73125))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5554"
FT   misc_feature    complement(72964..72981)
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen_5554"
FT   gene            complement(73768..74679)
FT                   /db_xref="GeneID:4097338"
FT                   /locus_tag="Bcen_5555"
FT   CDS_pept        complement(73768..74679)
FT                   /locus_tag="Bcen_5555"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   dar:Daro_0079 ABC transporter related"
FT                   /db_xref="GI:107028305"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4097338"
FT                   /translation="MQNPQAVPDYLIQSDAVRERFARLKARDVILDVRHVGKRFATPQG
FT                   ECVALDDISFRTHRREFVCVIGPSGCGKSTLIRILAGLDAQTSGDVLLDGKPVDGPGAD
FT                   RGMVFQGYTLFPWLTVKKNVMFGLRMNGSSSGVAEREALQWLDLVGLTRFADVYPHQLS
FT                   GGMKQRVAIARALANRPRILLMDEPFGALDAQTRARMQTHLLDIWRNIDVTILFITHDL
FT                   DEAIFLADRILVLKANPGGVQELIEVPVPRPRDYSQVNTPEFVATKARLEALIHPKEAA
FT                   TAEDDGIKPHMIRMTDVADNVE"
FT                   /protein_id="YP_625400.1"
FT   misc_feature    complement(73834..74598)
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(73933..74589)
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars...; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74458..74481)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(order(74020..74022,74119..74124,74350..74352,
FT                   74455..74463,74467..74472))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74350..74361)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74167..74196)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74119..74136)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74101..74112)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   misc_feature    complement(74014..74034)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen_5555"
FT   gene            complement(74725..75699)
FT                   /db_xref="GeneID:4097339"
FT                   /locus_tag="Bcen_5556"
FT   CDS_pept        complement(74725..75699)
FT                   /locus_tag="Bcen_5556"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dar:Daro_0080
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:107028306"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4097339"
FT                   /translation="MTTTRNTTGWLAVRRELTTRGKWTLALASFLLPFAVWCLISYVPF
FT                   VWHPQMRITNPGSVDYFQTGMQIDRDVFDDELAHARATHAAVPEGERANPVYLPAPHQV
FT                   LRAFYTAFTTPPASRDGVWLHESLWHSIRIIFWGFVISSAIGVPLGIVCGTFSALARLQ
FT                   EPFLEFFRYLPAPAFGALMVAILGIYDAPKIAIIVIGTLFQQVLIIANTTRKLEYGLFE
FT                   AAMTLGTKKLKLLTHVVIPGVLPDLYRDQRILLGWAWTYLIVAELVGTSSGITWYISQQ
FT                   ARYQHFDNVYAAILMIGIIGLGTDIVLGLLGRRLFPWDRTLKA"
FT                   /protein_id="YP_625401.1"
FT   misc_feature    complement(74746..75420)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Bcen_5556"
FT   gene            complement(75763..77635)
FT                   /db_xref="GeneID:4097340"
FT                   /locus_tag="Bcen_5557"
FT                   /pseudo
FT   gene            complement(77632..81249)
FT                   /db_xref="GeneID:4097341"
FT                   /locus_tag="Bcen_5558"
FT   CDS_pept        complement(77632..81249)
FT                   /locus_tag="Bcen_5558"
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /transl_table="11"
FT                   /note="PFAM: biotin/lipoyl attachment; Allophanate
FT                   hydrolase subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain-like; biotin
FT                   carboxylase-like; KEGG: nmu:Nmul_A0943 allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="GI:107028307"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:4097341"
FT                   /translation="MRFAKVLVANRGEIACRVIRTLKRLGIASVAIYSDADRDARHVAL
FT                   ADEAVRVGPAPAADSYLNVAAILAAARETGAQAVHPGYGFLSEHAGFADACEAAGLRFI
FT                   GPRGDHMRAFGLKHTARELAAAHGVALLPGTGLLDDVATALAEADAIGYPVMLKSTAGG
FT                   GGIGMSLCRDAAQLGAAFESVVRLGAANFAHAGVYLEKFVEHARHIEVQIFGDGRGGAI
FT                   ALGERDCSVQRRNQKVIEETPAPDLSAAERDALHASAVRLARAVGYASAGTVEFVFDAS
FT                   TRQFYFLEVNTRLQVEHCVTEAVTGVDLVEWMILQAEGDLPPLDTLAVVPRGASIQVRL
FT                   YAEDPNKQFQPSAGLLTHVAFPDDVRVDGWIEAGTEISAHYDPLLAKLIVRGDTRRDAL
FT                   AALRAALDQTELYGIETNLDYLRAVVGSDTFARGAPTTAFLSRFAFAPHTIDVLDGGVQ
FT                   TTVQQAPGRVGYWSVGVPPSGPMDDRAFDLANALLGNARDAAGLEFTMVGATLRFNTAT
FT                   LFVLGGAPLAATLDGEAVPFWQVVRARPGAVLKLGGVTGAGVRACLAVKGGLQVPDYLG
FT                   SKATFTLGQFGGHAGRALRKGDVLHLHADAGRGDAGAMLAAAEIPALTHAWTLGVLDGP
FT                   HGAPDFFTPDDIAMLYGTQWTVHYNSSRTGVRLIGPKPQWARADGGEAGLHPSNIHDNA
FT                   YAIGAVDFTGDMPVILGPDGPSLGGFVCPVTVVRDELWKLGQLRPGDTVQFVRAGVSAG
FT                   VSTAAVVDATRDVAAAASGASASFDDCVLHRDPSAGGGIGVVYRRSGDRNVLVEYGPLV
FT                   LDLNLRFRVHALMGWLDAHRLPGMLDLTPGIRSLQVQFDARTLPLDALLAHLQAAEREL
FT                   ADVADLRVPNRIVHLPLSWDDPSTRVAIERYMQSVRPDAPWCPSNIEFIRRINGLASID
FT                   DVKRIVFDARYLVMGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTPENAVGIGGAYL
FT                   CVYGMEGPGGYQFVGRTVQMWNRHRTTREFEAGKPWLLRFFDEIRFYEVSEAELTALRA
FT                   DFIAGRATLKIEESVFDLRAYNRFLHDEAESIAAFKATQQAAFDAERERWRAAGHAEYV
FT                   GDAEPGDAQADRVAGALDDTQRAIAADVSGSVWKVLVDAGERVTEGQVVAIVESMKMEV
FT                   AVTATEDGTIETIDCAPGAAVVAGQRLMVMKAGAAEEVA"
FT                   /protein_id="YP_625402.1"
FT   misc_feature    complement(77659..81243)
FT                   /note="urea carboxylase; Region: urea_carbox; TIGR02712"
FT                   /db_xref="CDD:162983"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(80917..81243)
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(80293..80901)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(79930..80241)
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(79015..79833)
FT                   /note="Allophanate hydrolase subunit 2; Region: AHS2;
FT                   cl00865"
FT                   /db_xref="CDD:176587"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(78103..78864)
FT                   /note="Allophanate hydrolase subunit 1 [Amino acid
FT                   transport and metabolism]; Region: DUR1; cl00896"
FT                   /db_xref="CDD:176822"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(77662..77862)
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(order(77737..77739,77758..77766,77791..77793))
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen_5558"
FT   misc_feature    complement(77761..77763)
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen_5558"
FT   gene            complement(81338..81994)
FT                   /db_xref="GeneID:4097342"
FT                   /locus_tag="Bcen_5559"
FT   CDS_pept        complement(81338..81994)
FT                   /locus_tag="Bcen_5559"
FT                   /gene_family="HOG000251570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tcx:Tcr_1791 hypothetical protein"
FT                   /db_xref="GI:107028308"
FT                   /db_xref="GeneID:4097342"
FT                   /translation="MPIIESRLDPRDAIHDVTLSAGDPWLHDLKRGQTFRILDLEGNQA
FT                   VDTLFYRTDDPEERYSAQDTIRSQRNLYLSAGSVLMSSRGNPMATIVADTCGRHDTLGG
FT                   ACAAESNTVRYALDKRYMHNCRDSFLNAISHCTCGAGARLTKRDLVGNVNFFMNVPVTP
FT                   LGGLTFEDGISAPGKYVEMRAEMDVTVLISNCPQLNNPCNGYNPTPVRLMIWEAE"
FT                   /protein_id="YP_625403.1"
FT   misc_feature    complement(81350..81961)
FT                   /note="Domain of unknown function (DUF1989); Region:
FT                   DUF1989; cl01474"
FT                   /db_xref="CDD:163985"
FT                   /locus_tag="Bcen_5559"
FT   gene            complement(82006..82761)
FT                   /db_xref="GeneID:4097343"
FT                   /locus_tag="Bcen_5560"
FT   CDS_pept        complement(82006..82761)
FT                   /locus_tag="Bcen_5560"
FT                   /gene_family="HOG000251569" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0072 hypothetical protein"
FT                   /db_xref="GI:107028309"
FT                   /db_xref="GeneID:4097343"
FT                   /translation="MSPSPQAILAPPPHVAWETLIPAGTHWSGILRRGLALRIVDVDGG
FT                   ANLSAVFHRQEDLLERYNMADTLKAQHTAHLTRGHALYTDMGRVIASITADTLGWHDPL
FT                   GGVGDARLFAHKYGTSSYQADRNAMIRNGRDSLVLELAKYGLSARDLAANVNFFSKLDA
FT                   RDDGALEFVAGHSPAGSAFDLRFEMNTLAAFSTAPHPLDPRPDYAPKAVKLIAYRAYPA
FT                   DGAAPDDDPCRRACAENMRGFANTDRLFA"
FT                   /protein_id="YP_625404.1"
FT   misc_feature    complement(82009..82719)
FT                   /note="Domain of unknown function (DUF1989); Region:
FT                   DUF1989; cl01474"
FT                   /db_xref="CDD:163985"
FT                   /locus_tag="Bcen_5560"
FT   gene            complement(82819..82951)
FT                   /db_xref="GeneID:4097344"
FT                   /locus_tag="Bcen_R0081"
FT   misc_RNA        complement(82819..82951)
FT                   /note="ykkC-yxkD element as predicted by Rfam (RF00442)"
FT                   /db_xref="GeneID:4097344"
FT                   /locus_tag="Bcen_R0081"
FT   gene            82961..83227
FT                   /db_xref="GeneID:4097345"
FT                   /locus_tag="Bcen_5561"
FT   CDS_pept        82961..83227
FT                   /locus_tag="Bcen_5561"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028310"
FT                   /db_xref="GeneID:4097345"
FT                   /translation="MLRTSRASNKRVACQPPLDDRTTRPGGAMPRDIRMTDAFACPRGG
FT                   RAAHHAHASAHRCSARRVLAHRPMRDGMGIAEPMHRHLISDPS"
FT                   /protein_id="YP_625405.1"
FT   gene            83383..83507
FT                   /db_xref="GeneID:4097346"
FT                   /locus_tag="Bcen_R0082"
FT   misc_RNA        83383..83507
FT                   /note="ykkC-yxkD element as predicted by Rfam (RF00442)"
FT                   /db_xref="GeneID:4097346"
FT                   /locus_tag="Bcen_R0082"
FT   gene            83647..84669
FT                   /db_xref="GeneID:4097347"
FT                   /locus_tag="Bcen_5562"
FT   CDS_pept        83647..84669
FT                   /locus_tag="Bcen_5562"
FT                   /gene_family="HOG000266414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0081 ABC transport system
FT                   substrate-binding protein"
FT                   /db_xref="GI:107028311"
FT                   /db_xref="GeneID:4097347"
FT                   /translation="MTRPAPALRHLPSFRFIRHALGAAVAAATLWAAPAVHAAAPLKIG
FT                   YSDWPGWVAFQVALDKGWFKEAGVDVDFEWFDYSASLDAFSAGKLDAVAATNGDALVTG
FT                   ASGAKNVMILLTDYSAGNDMIVAKPPLRTVEALKGKKIGVELGLVDHLLLETALQKHGL
FT                   KDGDVTLVNAKTNELPQVLGSSADIAAVAAWQPNAGEALKRAPGARAIFTSADAPGLIY
FT                   DAITVAPASLAARRADWAKVIKVWYRCVAYINDPKTQADAVKIMSARVGLAPAQYLPLL
FT                   KGTHLLDEAAAKRAFRKGDGLDSIYGSTRNANAFNVRNAVYKQSQDVDAYIDPRLVDAH
FT                   "
FT                   /protein_id="YP_625406.1"
FT   sig_peptide     83647..83763
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT                   /locus_tag="Bcen_5562"
FT                   /product="hypothetical protein"
FT   misc_feature    83773..84552
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_5562"
FT   gene            complement(84817..85536)
FT                   /db_xref="GeneID:4097169"
FT                   /locus_tag="Bcen_5563"
FT   CDS_pept        complement(84817..85536)
FT                   /locus_tag="Bcen_5563"
FT                   /gene_family="HOG000238352" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: psb:Psyr_2545
FT                   metallophosphoesterase"
FT                   /db_xref="GI:107028312"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:4097169"
FT                   /translation="MFSAAVDSLNRIRPEPDLVVISGDLTDEGTEDEYRKLRELLVELR
FT                   RPFVVLPGNHDDRGNLRAAFPDHAWLPDEGALSFALDVGELRLVALDTSVPGLHHGDLD
FT                   AETLAWLDTELAEHRNRTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRI
FT                   LAGHVHRSMQTRLGRVPVLTCPSTTTQIALRVEADAQPASFLEPPAYMLHRWAGRGQPA
FT                   VSHLCYVGHFEGPFPFA"
FT                   /protein_id="YP_625407.1"
FT   misc_feature    complement(84886..85536)
FT                   /note="Enterobacter aerogenes GpdQ and related proteins,
FT                   metallophosphatase domain; Region: MPP_GpdQ; cd07402"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen_5563"
FT   misc_feature    complement(order(84889..84891,84895..84897,84904..84906,
FT                   84991..84993,84997..85005,85012..85026,85045..85047,
FT                   85051..85053,85132..85137,85141..85143,85420..85422,
FT                   85447..85449,85456..85458,85513..85518,85525..85530))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen_5563"
FT   misc_feature    complement(order(84970..84972,85030..85032,85036..85038,
FT                   85153..85155,85372..85377,85456..85458,85465..85467))
FT                   /note="active site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen_5563"
FT   misc_feature    complement(order(85030..85032,85036..85038,85153..85155,
FT                   85375..85377,85465..85467))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen_5563"
FT   gene            complement(85820..86395)
FT                   /db_xref="GeneID:4097170"
FT                   /locus_tag="Bcen_5564"
FT   CDS_pept        complement(85820..86395)
FT                   /locus_tag="Bcen_5564"
FT                   /gene_family="HOG000078519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfl:PFL_2384 acetyltransferase, GNAT family, putative"
FT                   /db_xref="GI:107028313"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4097170"
FT                   /translation="MSINRGETESTFPTLTTSRLSLRELLPSDAPSLFAMHGDAEGMRW
FT                   FGTDPMTDIGEADKLIQVFADWRRSGSGVRWAVERLSDGHLLGTCGLFRWNRNWRSCAV
FT                   GYELATFARGKGYMNEALSAAIDYGFDTMQINRIEAQVHPQNASSIQVLETLGFVREGY
FT                   QRQAGYWRGAYHDLLQFSLLRSDCLRRG"
FT                   /protein_id="YP_625408.1"
FT   misc_feature    complement(85823..86311)
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="Bcen_5564"
FT   misc_feature    complement(85883..>86095)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen_5564"
FT   gene            complement(86662..87186)
FT                   /db_xref="GeneID:4097171"
FT                   /locus_tag="Bcen_5565"
FT   CDS_pept        complement(86662..87186)
FT                   /locus_tag="Bcen_5565"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:107028314"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4097171"
FT                   /translation="MLQCASPSSLPPPMSPSVDELLALDVLTLREHTERAGDAFDVDEH
FT                   RAKLCKSLEINELCYVRRDGKLVAYAMLRPEAGACWFVGAFGTHPLHRTYTVVNELFAK
FT                   IATLASERRIGELRSHVYKTNRLSIAFHRKLGFVVTRENEKGFEFSTTLDELATKPAVR
FT                   RATARATSRSD"
FT                   /protein_id="YP_625409.1"
FT   misc_feature    complement(86773..87006)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen_5565"
FT   gene            complement(87289..87750)
FT                   /db_xref="GeneID:4097172"
FT                   /locus_tag="Bcen_5566"
FT   CDS_pept        complement(87289..87750)
FT                   /locus_tag="Bcen_5566"
FT                   /gene_family="HOG000261967" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcz:BCZK2490 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="GI:107028315"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:4097172"
FT                   /translation="MSLQIDNESYMSRLRKKVGSDLILSPSVAAVIHDHEGKLLLQEKS
FT                   SGEAWSLPAGGVELGESPQEAIFREVMEETGYVIRIHGILGVFGGRLFRYTYPSGDRVE
FT                   YVVTLFQCKIIDGSGIPSDPETTSTRYFGRHDMPELALPYPKDDLFLPF"
FT                   /protein_id="YP_625410.1"
FT   misc_feature    complement(87316..87675)
FT                   /note="Members of the Nudix hydrolase superfamily catalyze
FT                   the hydrolysis of NUcleoside DIphosphates linked to other
FT                   moieties, X. Enzymes belonging to this superfamily require
FT                   a divalent cation, such as Mg2+ or Mn2+, for their activity
FT                   and contain a highly...; Region: Nudix_Hydrolase_17;
FT                   cd04676"
FT                   /db_xref="CDD:72911"
FT                   /locus_tag="Bcen_5566"
FT   misc_feature    complement(87520..87588)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72911"
FT                   /locus_tag="Bcen_5566"
FT   gene            complement(88000..88527)
FT                   /db_xref="GeneID:4097173"
FT                   /locus_tag="Bcen_5567"
FT   CDS_pept        complement(88000..88527)
FT                   /locus_tag="Bcen_5567"
FT                   /gene_family="HOG000082199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO7656 hypothetical protein"
FT                   /db_xref="GI:107028316"
FT                   /db_xref="GeneID:4097173"
FT                   /translation="MPTTAFVVDVPAAESTVADLRSRFGATSDLGVPAHITVLFPFMPP
FT                   DEITPDVLRQAQSALSVVQPFEFMLRKVERFAVTTYLAPDPPEPFVALTAALVERFPMF
FT                   RPYGGAHDGIVPHLTVAHGDAATAHLAAVELEHRLSARDAIRTCCSSVALLENSSGRWR
FT                   KMHLIDLPNVCV"
FT                   /protein_id="YP_625411.1"
FT   misc_feature    complement(<88168..88434)
FT                   /note="hypothetical protein; Provisional; Region: PRK13679"
FT                   /db_xref="CDD:172226"
FT                   /locus_tag="Bcen_5567"
FT   gene            complement(88607..89173)
FT                   /db_xref="GeneID:4097174"
FT                   /locus_tag="Bcen_5568"
FT   CDS_pept        complement(88607..89173)
FT                   /locus_tag="Bcen_5568"
FT                   /gene_family="HOG000266437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF925; KEGG:
FT                   cvi:CV4214 hypothetical protein"
FT                   /db_xref="GI:107028317"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="GeneID:4097174"
FT                   /translation="MNLNERLVEIARQSSWCMSALSAARAMGLKSWCIGAGAIRNLVWD
FT                   SLHGYVTPTRPADVDLAYFDPSDLSSIRDAEIQHSLTAQCPEIPWEVTNQAAVHLWFES
FT                   AFGHPVPPFSSLTQAVASWPEYATTVGLTLLGDGTIDVCAPYGLDDLFSMVVRRNPARV
FT                   SIDTYLRRIQQKRYKDRWPRVTIIV"
FT                   /protein_id="YP_625412.1"
FT   misc_feature    complement(88613..89113)
FT                   /note="Bacterial protein of unknown function (DUF925);
FT                   Region: DUF925; cl01435"
FT                   /db_xref="CDD:154400"
FT                   /locus_tag="Bcen_5568"
FT   gene            complement(89432..90394)
FT                   /db_xref="GeneID:4097175"
FT                   /locus_tag="Bcen_5569"
FT   CDS_pept        complement(89432..90394)
FT                   /locus_tag="Bcen_5569"
FT                   /gene_family="HOG000181312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_A4973
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="GI:107028318"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4097175"
FT                   /translation="MATKLSFEVLEVLDAIDRTGTFAEAAELLHRVPSTLTYLVQKLES
FT                   DMDVELFDRSGRRTRLTEAGRAVVEDGRRLLDAARHLEAKAKGIRDSWESELRLCVDAI
FT                   LPIQSLWPYVHAFYDLEMNTQLSLSTEVLGGVWDALVTRRADLAIGAFGEPPHAANIAA
FT                   RPIGTLRHVFVVAPDHPLARIPEPLESETIAGYRGVVISDTSRELQRQSVATRDGQPLV
FT                   IVPTLAAKLQALCEGIAVGMLPDFVAKEPIHEGRLVARRIVGVREFTNGYLAWREDKVG
FT                   NALNWWIAQLDSTDLLERLLTPRQESKGQPGTATCAVRY"
FT                   /protein_id="YP_625413.1"
FT   misc_feature    complement(89498..90382)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK11074"
FT                   /db_xref="CDD:170934"
FT                   /locus_tag="Bcen_5569"
FT   misc_feature    complement(90197..90376)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5569"
FT   misc_feature    complement(89522..90109)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen_5569"
FT   misc_feature    complement(order(89687..89692,89696..89701,89717..89734,
FT                   90005..90025,90029..90031,90041..90043,90050..90055,
FT                   90059..90064))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen_5569"
FT   gene            91209..91442
FT                   /db_xref="GeneID:4097176"
FT                   /locus_tag="Bcen_5570"
FT   CDS_pept        91209..91442
FT                   /locus_tag="Bcen_5570"
FT                   /gene_family="HOG000266438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B3675 hypothetical protein"
FT                   /db_xref="GI:107028319"
FT                   /db_xref="GeneID:4097176"
FT                   /translation="MNPEQARAEETQAMERMVAATLRVQSTFASMQKQFPPQGSGEPSP
FT                   FALQTFDAALQELEDAQAAFDALLNDLIDGNR"
FT                   /protein_id="YP_625414.1"
FT   gene            complement(91581..92703)
FT                   /db_xref="GeneID:4097177"
FT                   /locus_tag="Bcen_5571"
FT                   /pseudo
FT   gene            92949..94214
FT                   /db_xref="GeneID:4097178"
FT                   /locus_tag="Bcen_5573"
FT   CDS_pept        92949..94214
FT                   /locus_tag="Bcen_5573"
FT                   /gene_family="HOG000156337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="poly(3-hydroxybutyrate) depolymerase-like"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7221 poly(3-hydroxybutyrate)
FT                   depolymerase-like"
FT                   /db_xref="GI:107028320"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="GeneID:4097178"
FT                   /translation="MRVTPVPPGAALRLPRHRQHEPCFAPVRLPSDGGVGRLFPSRPAA
FT                   GTKLHMPRKKSSLWLRHLELFSIATGARPKKRAGKPRPAAPKAAKKVVQRTIKPAVAAP
FT                   AAKRTGAAPAARAPSVEPPGTWLRSFHSAGPSAGRLVNHLAYALYLPAAPAKTAGMPAV
FT                   VMLHGCKQTAESFAAGTRICRLAERAGFAVLFPEQAKTTHAHRCWHWHGDATESEAAAV
FT                   ASLVDAIVRRHGFDRDRIYVAGLSAGAGLAAALALRYPDRFAAVGLHSGPAIAPPSSTM
FT                   AAMSLMRRGLRDDPVAALDACADVASYPGMPALVIHGALDTVVTDRNATQLGIAFARLN
FT                   RLVDEHGAIRIGEQRSYAQDDADYIDYLKGGRLVVRVCIVRRLPHAWSGGDPSEPFHSA
FT                   KGPDATAMFWHFFRRQRRKRLA"
FT                   /protein_id="YP_625415.1"
FT   misc_feature    93426..94010
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen_5573"
FT   gene            complement(94262..96097)
FT                   /db_xref="GeneID:4097179"
FT                   /locus_tag="Bcen_5574"
FT   CDS_pept        complement(94262..96097)
FT                   /locus_tag="Bcen_5574"
FT                   /gene_family="HOG000266460" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region, ATPase-like; histidine
FT                   kinase A-like; MHYT; KEGG: bur:Bcep18194_C7222 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="GI:107028321"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4097179"
FT                   /translation="MAAGRALAPAAAMHSTRCGRPIMHGIYNLPLVVLSLAIATLASYT
FT                   TLDLAAFISLLDDPKLKRAWLGGGAAAMGTGIWSMHFVGMLAFSLPVPLGYAWQETGAS
FT                   LAIAVLVSYFALNVVTRARLGWRRLCMGGVLMGGGIAGMHYTGMAAMHMQPGIRYDAAL
FT                   FAASIGIAVIASTAALWIAQALRMQQARHATAQRIGAAVIMGLAITGMHYTAMAAAHFA
FT                   PDARCGAANGVDAPWLATTVALFTMATLVVTLLVCRFDARTTFLRGMTDTLERLVRVRT
FT                   GELERALYSYEQTTRMLQRTRENMAAEIDERKAAHALLEQEKDEQRRLLHALEETHEQL
FT                   LQSEKLASIGQLAAGVAHEINNPIGFVSANLNTLKTWVRSLLDVVAAHEAALPQLDPAT
FT                   RDALTAVHRAVDLDYVRDEIAMLIDESIDGALRVRRIVQDLRDFSRPASDEWSVVDLHA
FT                   GLESTLNVVHNELKYKADIVRDYGDVPHVECLPSQLNQVFMNLLVNAAQAIPERGVITI
FT                   RTSSDGDQVSIAISDTGAGMTPDVVRRIFDPFFTTKPVGQGTGLGLSVSHGIVERHRGT
FT                   IDVTSEPGRGTTFRIRLPVRRAGDRASAAALEQRA"
FT                   /protein_id="YP_625416.1"
FT   misc_feature    complement(95330..96031)
FT                   /note="MHYT domain (predicted integral membrane sensor
FT                   domain) [Signal transduction mechanisms]; Region: COG3300"
FT                   /db_xref="CDD:33109"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(95711..95878)
FT                   /note="Bacterial signalling protein N terminal repeat;
FT                   Region: MHYT; pfam03707"
FT                   /db_xref="CDD:112517"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(95540..95668)
FT                   /note="Bacterial signalling protein N terminal repeat;
FT                   Region: MHYT; pfam03707"
FT                   /db_xref="CDD:112517"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(94295..>95125)
FT                   /note="sensory histidine kinase AtoS; Provisional; Region:
FT                   PRK11360"
FT                   /db_xref="CDD:171082"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(94319..94618)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(order(94331..94333,94337..94342,94355..94357,
FT                   94361..94363,94409..94420,94487..94492,94496..94498,
FT                   94502..94504,94508..94510,94577..94579,94586..94588,
FT                   94598..94600))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(94586..94588)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_5574"
FT   misc_feature    complement(order(94412..94414,94418..94420,94490..94492,
FT                   94496..94498))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen_5574"
FT   gene            complement(96115..97533)
FT                   /db_xref="GeneID:4097180"
FT                   /locus_tag="Bcen_5575"
FT   CDS_pept        complement(96115..97533)
FT                   /locus_tag="Bcen_5575"
FT                   /gene_family="HOG000266481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase, HD subdomain; KEGG: bur:Bcep18194_C7223
FT                   response regulator receiver (CheY-like) modulated
FT                   metal-dependent phosphohydrolase"
FT                   /db_xref="GI:107028322"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:4097180"
FT                   /translation="MTTSATNGVNAVAPETSDTAAASASVEVPRVPSILLVDDEPNVVS
FT                   ALRRVFRPAGYDIVTADSGETALEILASTDIDLIVSDMRMPHMSGAEFLARARALYPDT
FT                   MRILLTGYAELASVVQAVNEGGVYRYLNKPWDDHDLLLTIEQALEQRRLRREAARLAAL
FT                   TEAQNEALRRFNTDLETQVRARTEELGQTVMFLEAAQSDLKSSFTAMVQVCASMIELRC
FT                   GAASGHAMRVGEIARRLALASGMSELHAQDVYFAGLLHGIGKLSLPDELLHKPLARMTT
FT                   DEHRVFQEHPLRAQMVLTPVAQLHKVASIVLHQYERFNGRGTPDGLVGDAIPIGSRIVA
FT                   IARDFEGLRHGEIGAPHSIEQAIDVLRSQASVRYDPQLVAGFIELMRDPASLGIAASVA
FT                   EIRSAQLREGMELADDLRTHRGVLLMTKGSVMSAHQIELVRRFETREGTPFDILVLAGP
FT                   AAQAHAPNAGVPPA"
FT                   /protein_id="YP_625417.1"
FT   misc_feature    complement(96379..97470)
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HD-GYP domain [Transcription / Signal
FT                   transduction mechanisms]; Region: COG3437"
FT                   /db_xref="CDD:33243"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(97102..97431)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(order(97132..97137,97144..97146,97204..97206,
FT                   97264..97266,97288..97290,97417..97422))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(97288..97290)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(order(97264..97272,97276..97281))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(97129..97137)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(96487..96852)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cd00077"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(order(96505..96507,96751..96756,96850..96852))
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen_5575"
FT   misc_feature    complement(96751..96753)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen_5575"
FT   gene            complement(97655..98110)
FT                   /db_xref="GeneID:4097181"
FT                   /locus_tag="Bcen_5576"
FT   CDS_pept        complement(97655..98110)
FT                   /locus_tag="Bcen_5576"
FT                   /gene_family="HOG000221500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C7224 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:107028323"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4097181"
FT                   /translation="MTTTLTFLPVTQADADALVAIRIAAMRDSLERIGRFDPQRARDRF
FT                   LASFDPALCRFIEAGHSRAGFYTLRPMADHWLLDHLYIVPAHQGKGIGAAVLREIFAAA
FT                   DERRMPVRVGALRGSDSNRFYERHGFVRTDEAEWDIYYRREPGTAAT"
FT                   /protein_id="YP_625418.1"
FT   misc_feature    complement(97718..97921)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen_5576"
FT   gene            complement(98368..98772)
FT                   /db_xref="GeneID:4097182"
FT                   /locus_tag="Bcen_5577"
FT   CDS_pept        complement(98368..98772)
FT                   /locus_tag="Bcen_5577"
FT                   /gene_family="HOG000266482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7252 hypothetical protein"
FT                   /db_xref="GI:107028324"
FT                   /db_xref="GeneID:4097182"
FT                   /translation="MMIGSESAAFFMLRLGTPHPSWAFTDDSNMLGIGDCDGVMSAMFE
FT                   LDRNQVARIRRLGQSVERIRCTCERAGRELHFYLHGRQVSQGVWVGVASADPDYLPTDE
FT                   MIATWEVPKPDDAFRSTGAGADLIASLSLA"
FT                   /protein_id="YP_625419.1"
FT   misc_feature    complement(<98479..98772)
FT                   /note="RNase II stability modulator; Provisional; Region:
FT                   PRK10060"
FT                   /db_xref="CDD:170227"
FT                   /locus_tag="Bcen_5577"
FT   sig_peptide     complement(98701..98772)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.899) with cleavage site probability 0.898 at
FT                   residue 24"
FT                   /locus_tag="Bcen_5577"
FT                   /product="hypothetical protein"
FT   gene            complement(98943..100148)
FT                   /db_xref="GeneID:4097183"
FT                   /locus_tag="Bcen_5578"
FT   CDS_pept        complement(98943..100148)
FT                   /locus_tag="Bcen_5578"
FT                   /gene_family="HOG000208778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bur:Bcep18194_C7251 sodium-dicarboxylate symporter"
FT                   /db_xref="GI:107028325"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="GeneID:4097183"
FT                   /translation="MQMLGGLVLGAACGVFAPGFAAKLGFLSAMFGHAIKMVVMPLIFL
FT                   SVTVGVFRAGRLRERLGKVALSSIGFFVLMTGLAASLGLLLNFAFRPGLGASMVQSGSM
FT                   PAALASSIDWTKFLVDLIPANIVAALAAGNSLPVLVFGVIFGAALAAAPERAEPAIAVF
FT                   EALLSGLFKMVQWVIAWSPLAIFAAIAQLLSAKGFTGAHSLVELLGVAYLGMAILAVVL
FT                   TIVIRVAGQSPLAVLRKVKEPLILGFTTRSSEITYPLHLKKLVELGVPYGVASTILPLA
FT                   YIFNRDGAVLYTALAVGYLADAYHLVWSWPLVITILILTIITIDGAANVPSGAIVAITI
FT                   VLTSIGLPADAVLLLLGVDAFFDMGRTALNVYGSTAAAAVAVRLSGSDSIAAETVPRQA
FT                   SV"
FT                   /protein_id="YP_625420.1"
FT   sig_peptide     complement(100083..100148)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.961 at
FT                   residue 22"
FT                   /locus_tag="Bcen_5578"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(98997..100103)
FT                   /note="Sodium:dicarboxylate symporter family; Region: SDF;
FT                   cl00573"
FT                   /db_xref="CDD:174292"
FT                   /locus_tag="Bcen_5578"
FT   gene            complement(100165..100827)
FT                   /db_xref="GeneID:4097184"
FT                   /locus_tag="Bcen_5579"
FT   CDS_pept        complement(100165..100827)
FT                   /locus_tag="Bcen_5579"
FT                   /gene_family="HOG000266493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR-like; KEGG:
FT                   bur:Bcep18194_C7250 transcriptional regulator, GntR family"
FT                   /db_xref="GI:107028326"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:4097184"
FT                   /translation="MTSKVSTDAELAYEEIRARIFDGRFAPGQKVSHRGLSDELGFGQM
FT                   PVRSALHLLESEGLVVVIEKSGTYVASPTTSDLREIFEMRLALESTAAFLAARSGVTAG
FT                   LRDAAAKMQELLDRDVADIMLEQRIGWVFHQELFAAARNVRISSAYGLLRAQTLALNEL
FT                   PRGDAETVRRGTIEHLHIFHAIEANDGELARQHMWNHIVDGTPARIKLLKARHEHEK"
FT                   /protein_id="YP_625421.1"
FT   misc_feature    complement(100183..100827)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="Bcen_5579"
FT   misc_feature    complement(100615..100803)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_5579"
FT   misc_feature    complement(order(100624..100635,100639..100644,
FT                   100672..100674,100681..100686,100690..100704,
FT                   100726..100731,100801..100803))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen_5579"
FT   misc_feature    complement(100225..100590)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Bcen_5579"
FT   gene            100978..101442
FT                   /db_xref="GeneID:4097185"
FT                   /locus_tag="Bcen_5580"
FT   CDS_pept        100978..101442
FT                   /locus_tag="Bcen_5580"
FT                   /gene_family="HOG000085386" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C7249 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:107028327"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4097185"
FT                   /translation="MTSQGVRFTICAVRAEETYPLRAAILMAGDEEGSALHGDHAPTTL
FT                   HFAVRDNDTIVAVASVCKEGQSGVPNAEAWRLRGMAVHPSVRGLGFGRLLVNLSIRHVR
FT                   EQRGTLLWCTARESAYQFYEMLGFNRDPIPISLHGRDDMKFYLMQRPIEC"
FT                   /protein_id="YP_625422.1"
FT   misc_feature    101113..101319
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Bcen_5580"
FT   misc_feature    order(101215..101223,101251..101256)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Bcen_5580"
FT   gene            101488..101799
FT                   /db_xref="GeneID:4097186"
FT                   /locus_tag="Bcen_5581"
FT   CDS_pept        101488..101799
FT                   /locus_tag="Bcen_5581"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028328"
FT                   /db_xref="GeneID:4097186"
FT                   /translation="MSRSWLPARKTRSTGARLSRFARAKIEIACGAFSPQKNHPKLSAA
FT                   VSHAESAYDLYGHALINRAFHFDYRNPKANGTVTTGTAGLLLAMAVPCSRLSSPHDPT"
FT                   /protein_id="YP_625423.1"
FT   gene            102211..103377
FT                   /db_xref="GeneID:4097187"
FT                   /locus_tag="Bcen_5582"
FT   CDS_pept        102211..103377
FT                   /locus_tag="Bcen_5582"
FT                   /gene_family="HOG000114656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="porin"
FT                   /transl_table="11"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_C7455 outer membrane protein (porin)"
FT                   /db_xref="GI:107028329"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="GeneID:4097187"
FT                   /translation="MKNKKINISVIAVAAFAASSAAMAQSSVTLYGMLDAGIGYTSNIN
FT                   GHSRFGLDGGAAGSNKWGLRGQEDLGGGLQAVFKIENGFNIATGGIGGQGPIGTTRSLF
FT                   NRQAYVGLASSQYGALRMGRQLDAVTEMVQVLTGDAISASTFSTPGDVDNNDNTTNQNN
FT                   AVKYISPIIHGFQAEAAYSFGGVAGSTGSGQSWSAAATYAQGGLTVAGGYFRAANQGEN
FT                   GWTNATAQPSFGGALGYPSSGYNGGNAFKSAGIAQVAAQYEVGPYTAGLRYSNAQYKGN
FT                   DGQPSIHFNVLGALLQYRVTPALSLATGYTYVYGSAATPTQAAEGRTMASINQVSLGAT
FT                   YSLSKSTALYAMGAYVHAKGAQASAADFGNTSSGGNQVQVNIGMFHGF"
FT                   /protein_id="YP_625424.1"
FT   sig_peptide     102211..102285
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT                   /locus_tag="Bcen_5582"
FT                   /product="hypothetical protein"
FT   misc_feature    102295..103374
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen_5582"
FT   misc_feature    order(102307..102309,102391..102393,102526..102528,
FT                   102622..102624,102688..102690)
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen_5582"
FT   misc_feature    order(102310..102312,102316..102324,102406..102420,
FT                   102436..102438,102442..102450,102454..102456,
FT                   102460..102471,102523..102528,102532..102546,
FT                   102574..102582,102688..102690,102694..102699,
FT                   103237..103242,103249..103251,103360..103362,
FT                   103366..103368,103372..103374)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen_5582"
FT   gene            complement(103410..104375)
FT                   /db_xref="GeneID:4096771"
FT                   /locus_tag="Bcen_5583"
FT   CDS_pept        complement(103410..104375)
FT                   /locus_tag="Bcen_5583"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2674
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="GI:107028330"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4096771"
FT                   /translation="MERKSHVMSESRDVAKHRGELPPLNALRAFDAVARHGSFAGAAAE
FT                   LHVTHWAVGKQIRLLEDWFGLPLFDRRPRGVALTDEGAALLNDVSHAFERLGTAVVRLR
FT                   HNTFTHRISGVVRVNVPMSFAFCWLLPRLADFHSRYPDIDVRVSTTSRKLRYVADAFDI
FT                   GVRSGPEQGAGVVSRPLMPDLRVPACNPALLRQHPIQSVADLRHHTLLHSATTRSAWSH
FT                   WLKEAGASDLRAARHVEFDHVNLQLGAAIEGLGVALASLPLIGRDLAEGRLVCPIASPV
FT                   WRADDYMLVTNADRADDAAVSAFEEWMEGMASRQGGTTPE"
FT                   /protein_id="YP_625425.1"
FT   misc_feature    complement(103434..104315)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:170976"
FT                   /locus_tag="Bcen_5583"
FT   misc_feature    complement(104130..104306)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen_5583"
FT   misc_feature    complement(103452..104033)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen_5583"
FT   misc_feature    complement(order(103929..103949,103953..104006,
FT                   104010..104033))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen_5583"
FT   misc_feature    complement(order(103587..103589,103647..103655,
FT                   104004..104006,104010..104015))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen_5583"
FT   gene            104493..105713
FT                   /db_xref="GeneID:4096772"
FT                   /locus_tag="Bcen_5584"
FT   CDS_pept        104493..105713
FT                   /locus_tag="Bcen_5584"
FT                   /gene_family="HOG000266504" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2673 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:107028331"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4096772"
FT                   /translation="MRLPVFSPPVTRETAPPRRRALWLSCVAHAMHDGYTDMIYALLPV
FT                   WQSEFGLDFAALAILRGVYAGTMATLQLSAGRLAQRLGSRATLALGTLLAALGYALAGM
FT                   SGGLLGLGVALAISGGGSSTQHPIASGAVSRFYGRDARGPLSIYNFSGDLGKSALPAAI
FT                   SLLVTLMPWRHALWIVAGLGCVVAAVIALWFPAVPRGGANTTAKEHASAQRGGTGKSGF
FT                   SALFSIGVLDTAVRMGLLTFLPFLLKAKGVSPQLLGTALALVFIGGAAGKFMCGWLGAR
FT                   LGMVRTVLLTEGGTAACIIAVMYLPLAPSMVLLPILGMMLNGTSSVLYGTVPELSAPER
FT                   TERAFAIFYTGTIASGALSPVLYGFLGDRIGVHGATYATALTALAIFPLALALRPHLAD
FT                   DPTGGTP"
FT                   /protein_id="YP_625426.1"
FT   misc_feature    104556..105614
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5584"
FT   misc_feature    order(104598..104600,104607..104615,104619..104624,
FT                   104673..104675,104682..104687,104694..104696,
FT                   104706..104711,104715..104720,104856..104861,
FT                   104868..104873,104880..104885,104892..104894,
FT                   104925..104930,104937..104942,104958..104960,
FT                   105186..105188,105195..105200,105207..105212,
FT                   105219..105221,105261..105263,105273..105275,
FT                   105285..105287,105294..105296,105306..105308,
FT                   105444..105446,105453..105458,105465..105467,
FT                   105477..105482,105489..105491,105522..105527,
FT                   105534..105539,105546..105551,105558..105560)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen_5584"
FT   gene            105710..106606
FT                   /db_xref="GeneID:4096773"
FT                   /locus_tag="Bcen_5585"
FT   CDS_pept        105710..106606
FT                   /locus_tag="Bcen_5585"
FT                   /gene_family="HOG000050226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE-like; KEGG:
FT                   eca:ECA1579 probable ketopantoate reductase"
FT                   /db_xref="GI:107028332"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="GeneID:4096773"
FT                   /translation="MTKSGYPSVALVGPGAIGTTVAAALHEAGRTPVICGRSAHAELKL
FT                   RFDGGEIVVPGPVLTDPQAVKETVDLVFVAVKSTQTASAAPWVAALCDANTVICVLQNG
FT                   VEQKAAFAPYAAGAAIVPSVVWFPAQRESGASVWLRAKPRLTLPDTPASNVVVSALRGT
FT                   RCAPEVAEDFISLAWRKLLQNAVAGLMVLTGRRAGMFSRSDITELSLAYLKECLAVARA
FT                   EGAKLGDEVPQEIVDAFHGFPPDLGTSILADRQGNHPLEWDCRNGVVQRYGRTHGIPTP
FT                   ISDLVVPLLAAASDGPG"
FT                   /transl_table="11"
FT                   /protein_id="YP_625427.1"
FT   sig_peptide     105710..105778
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.874) with cleavage site probability 0.542 at
FT                   residue 23"
FT                   /locus_tag="Bcen_5585"
FT                   /product="2-dehydropantoate 2-reductase"
FT   misc_feature    105728..106603
FT                   /note="2-dehydropantoate 2-reductase; Provisional; Region:
FT                   PRK12921"
FT                   /db_xref="CDD:171816"
FT                   /locus_tag="Bcen_5585"
FT   misc_feature    105734..106162
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen_5585"
FT   misc_feature    106223..106585
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="Bcen_5585"
FT   gene            complement(106741..107340)
FT                   /db_xref="GeneID:4096774"
FT                   /locus_tag="Bcen_5586"
FT   CDS_pept        complement(106741..107340)
FT                   /locus_tag="Bcen_5586"
FT                   /gene_family="HOG000266525" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI; KEGG: bur:Bcep18194_C7256 ThiJ/PfpI
FT                   family protein"
FT                   /db_xref="GI:107028333"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:4096774"
FT                   /translation="MHIAIVTFQGFNELDSLIALGVLNRIRKPGWRVTLACPEPSVTSM
FT                   NGITVHAQSTLADACTADAVIIGSGIQTRDVVNDAALMAQLRFDPARQLIGAQCSGTLI
FT                   LAKLGLLGTIPACTDLTTKPWVIEAGVDVLNQPFFARGNVATAGGCLASPYLAAWLIAR
FT                   LEGEDAARGALHYVAPVGEKDEYVSRALTNIKPYLR"
FT                   /protein_id="YP_625428.1"
FT   misc_feature    complement(106828..107334)
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain; Region: GAT_1; cl00020"
FT                   /db_xref="CDD:173987"
FT                   /locus_tag="Bcen_5586"
FT   misc_feature    complement(107044..107046)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153222"
FT                   /locus_tag="Bcen_5586"
FT   gene            107750..108907
FT                   /db_xref="GeneID:4096775"
FT                   /locus_tag="Bcen_5587"
FT   CDS_pept        107750..108907
FT                   /locus_tag="Bcen_5587"
FT                   /gene_family="HOG000266526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_I0078 hypothetical protein"
FT                   /db_xref="GI:107028334"
FT                   /db_xref="GeneID:4096775"
FT                   /translation="MNNIIKSALCAAFVPFVLAGCGGGDDGGGTQTGTLHVAMTDAPSC
FT                   GFDHVYVTVSQVRVNANANAADNDAGWSTVSLATPQKIDLLSLTNGVLADLGQTALPAG
FT                   QYQQVRLVLAQNQGNNLANSVVPTGGVEQALATPSATQSGYKIIQPFTVQPNTLVDLVL
FT                   DFNACKSIVQRGNGSYALKPVVTAIPTVVSGAISGYVASAEAGATVYAEQGGKVVRGTV
FT                   ADSSGKFVLSPLIQSSTQGNYDVVIVQNNFASGIVRSVPVVVNTTTAVSASTAPITLPA
FT                   STTSTVSGTVTASVNAFVRALQTVDANAYEITSINANMDTGAYSLSVPAAAPIVGTYSG
FT                   SLPVALAAAPAAAGQYTIEADAASGATQSANVNATTSQSNVNFSF"
FT                   /protein_id="YP_625429.1"
FT   sig_peptide     107750..107824
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.458 at
FT                   residue 25"
FT                   /locus_tag="Bcen_5587"
FT                   /product="hypothetical protein"
FT   gene            108967..109128
FT                   /db_xref="GeneID:4096776"
FT                   /locus_tag="Bcen_5588"
FT   CDS_pept        108967..109128
FT                   /locus_tag="Bcen_5588"
FT                   /gene_family="HOG000266539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSL0094 putative lipoprotein"
FT                   /db_xref="GI:107028335"
FT                   /db_xref="GeneID:4096776"
FT                   /translation="MKKGVIALLAAASMVGALSGCVAYVPGPPVVVAPQGGPGNGFCPP
FT                   GQAKKGNC"
FT                   /protein_id="YP_625430.1"
FT   sig_peptide     108967..109038
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.696 at
FT                   residue 24"
FT                   /locus_tag="Bcen_5588"
FT                   /product="hypothetical protein"
FT   gene            complement(109210..109683)
FT                   /db_xref="GeneID:4096777"
FT                   /locus_tag="Bcen_5589"
FT   CDS_pept        complement(109210..109683)
FT                   /locus_tag="Bcen_5589"
FT                   /gene_family="HOG000109158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RS03923 hypothetical protein"
FT                   /db_xref="GI:107028336"
FT                   /db_xref="GeneID:4096777"
FT                   /translation="MEAAMQWITRQRPKIDRVACPWLIARFIDETPEFLYVPPGDVLRI
FT                   ANETGAIPYDIPGVELTHVGEQCSFDAFLDKYGLADDRALQHMARIIRGADTSRLDLTP
FT                   QSSGLYAISLGLSDMFSDDHDMLEHGLVMYDALYAWCRHCQAEGHAWPPKMAE"
FT                   /protein_id="YP_625431.1"
FT   misc_feature    complement(109258..109665)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcen_5589"
FT   gene            complement(109686..110858)
FT                   /db_xref="GeneID:4096778"
FT                   /locus_tag="Bcen_5590"
FT   CDS_pept        complement(109686..110858)
FT                   /locus_tag="Bcen_5590"
FT                   /gene_family="HOG000263790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Chromate transporter; KEGG: rso:RSp0555
FT                   probable chromate transport transmembrane protein"
FT                   /db_xref="GI:107028337"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4096778"
FT                   /translation="MNTHRDRPAYTLWQLTRYFAWLGATGFGGPVALAGYMHRDLVDTR
FT                   GWIADADYKEGLALAQLAPGPLAAQLAIYLGYVHYRIVGATLVGIAFVLPSFLMVVLLG
FT                   YAYTQFGGLTWMQSVFYGVGAAVIGIIAISARKLTAKSIGHDKLLWAIYLALVAVTVIT
FT                   ESEVAWLFLAAGLVVWFTRAPPKWLRQRRVNAVMALPVSATGAWLGIVDWPQLAQLAAF
FT                   FAKAGAFVFGSGLAIVPFLYGGVVTEHHWLNEKQFVDAVAVAMITPGPVVITVGFIGYL
FT                   VAGLPGACVAAAGTFLPCYLFTVLPAPYFKKYGRLPAILAFVDGVTAAAVGAITGSVIV
FT                   LARRSIVDVPTALMALAAIVLLVRFKKLSEPVVVGGAAVIGLIVYPLLHH"
FT                   /protein_id="YP_625432.1"
FT   misc_feature    complement(110262..110837)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcen_5590"
FT   misc_feature    complement(109746..110804)
FT                   /note="chromate transporter, chromate ion transporter (CHR)
FT                   family; Region: 2A51; TIGR00937"
FT                   /db_xref="CDD:162120"
FT                   /locus_tag="Bcen_5590"
FT   misc_feature    complement(<109902..110159)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcen_5590"
FT   gene            complement(110878..111840)
FT                   /db_xref="GeneID:4096779"
FT                   /locus_tag="Bcen_5591"
FT   CDS_pept        complement(110878..111840)
FT                   /locus_tag="Bcen_5591"
FT                   /gene_family="HOG000266560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative chromate resistance signal peptide
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RSp0554 probable chromate resistance
FT                   signal peptide protein"
FT                   /db_xref="GI:107028338"
FT                   /db_xref="GeneID:4096779"
FT                   /translation="MNPVPTSWLLLIVSLPTSGATARMRIWRTVKALGCGALRDGAYLL
FT                   PAHAEQAAQLRELADEARNGDGQAWLLDVRADDPADEDAYKRLFDRAGDYAAWLAELSE
FT                   ARQTLPDLTAADLNRLQRRHARTYEAIRSIDFFPGETSLRAQAQWRDFTAAIEALRSPG
FT                   EPHAAQRGIPRRDPAQYQGRLWATRRHLWVDRVASAWLIRRFIDPHARFVWLDNLADCP
FT                   ADALGFDFDGAPFTHVGDRVSFEVLIASFGLDDNAGLVRLGAMVHALDVGGATVPEAGG
FT                   FEAILAGARKRLADDDALLMEIGAVLDSLYVHFRGNRNP"
FT                   /protein_id="YP_625433.1"
FT   sig_peptide     complement(111781..111840)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.879) with cleavage site probability 0.472 at
FT                   residue 20"
FT                   /locus_tag="Bcen_5591"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(110896..111288)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcen_5591"
FT   gene            112203..112532
FT                   /db_xref="GeneID:4096780"
FT                   /locus_tag="Bcen_5592"
FT   CDS_pept        112203..112532
FT                   /locus_tag="Bcen_5592"
FT                   /gene_family="HOG000221269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028339"
FT                   /db_xref="GeneID:4096780"
FT                   /translation="MQLDGKRRPAHETAPMTIDPGSIPYYLVLRAGWPPYVLNSDRQVL
FT                   RRQASPLLLAFARTRGAIAHVDDSAWNGFSDSEGLTVVERRETGFFSLVAGNETERQLQ
FT                   LLTTL"
FT                   /protein_id="YP_625434.1"
FT   gene            112791..113123
FT                   /db_xref="GeneID:4096781"
FT                   /locus_tag="Bcen_5593"
FT   CDS_pept        112791..113123
FT                   /locus_tag="Bcen_5593"
FT                   /gene_family="HOG000221324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_1292 hypothetical protein"
FT                   /db_xref="GI:107028340"
FT                   /db_xref="GeneID:4096781"
FT                   /translation="MCSPMRLVVAERQEFVMSMHVYRGFEIYPLIYPHVAAPQGCPHNY
FT                   DAGFDAAVKICLRGTTDTLTQSQTFRLRDTAPFDNAGDARRASVRYAENIIDDNRGKQG
FT                   FFSSAG"
FT                   /protein_id="YP_625435.1"
FT   gene            113127..113381
FT                   /db_xref="GeneID:4096782"
FT                   /locus_tag="Bcen_5594"
FT   CDS_pept        113127..113381
FT                   /locus_tag="Bcen_5594"
FT                   /gene_family="HOG000266561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107028341"
FT                   /db_xref="GeneID:4096782"
FT                   /translation="MLAGATQFFGILEDEMIIDELLGLIRRNEVTRIDTVVPARIADSA
FT                   MCHQPELHMFMAVRALSIGAGYSEFESDEIASAVMTRLG"
FT                   /protein_id="YP_625436.1"
FT   gene            113415..113627
FT                   /db_xref="GeneID:4096783"
FT                   /locus_tag="Bcen_5595"