(data stored in ACNUC8465 zone)

HOGENOMDNA: BURCC_2

ID   BURCC_2; SV 1; empty ; DNA; empty ; PRO; 1224595 BP.
XX
AC   NC_010512;
XX
PR   Project: 58769;
XX
DE   Burkholderia cenocepacia MC0-3 chromosome 3, complete sequence.
XX
OS   Burkholderia cenocepacia MC0-3
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1224595
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Bruce,D., Goodwin,L., Glavina
RA   del Rio,T., Dalin,E., Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Mikhailova,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of chromosome3 of Burkholderia cenocepacia MC0-3";
RL   Unpublished
XX
RN   [2]
RP   1-1224595
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-MAR-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1224595
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Bruce,D., Goodwin,L., Glavina
RA   del Rio,T., Dalin,E., Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Mikhailova,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (27-FEB-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000960.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002674
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1224595
FT                   /strain="MC0-3"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia cenocepacia MC0-3"
FT                   /chromosome="3"
FT                   /db_xref="taxon:406425"
FT   gene            330..707
FT                   /db_xref="GeneID:6126024"
FT                   /locus_tag="Bcenmc03_6016"
FT   CDS_pept        330..707
FT                   /locus_tag="Bcenmc03_6016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   bur:Bcep18194_C7002 transcriptional regulator, LysR family"
FT                   /db_xref="GI:170734518"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="GeneID:6126024"
FT                   /translation="MNLLEAMRIFGAIVEHGGLSGAASELKLDVAQVGARLDGLERYLG
FT                   CRLLLDRSGDEVACTEAGVAFYACCRRTLSAVAQATGASGAEACATVSRSPVAGFPLPE
FT                   TPRCGDGTSIAAPTTLHRLTR"
FT                   /protein_id="YP_001773632.1"
FT   misc_feature    339..518
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bcenmc03_6016"
FT   gene            704..1156
FT                   /db_xref="GeneID:6124992"
FT                   /locus_tag="Bcenmc03_6017"
FT   CDS_pept        704..1156
FT                   /locus_tag="Bcenmc03_6017"
FT                   /gene_family="HOG000293672" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphate-starvation-inducible E"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate-starvation-inducible E; KEGG:
FT                   bam:Bamb_5664 phosphate-starvation-inducible E"
FT                   /db_xref="GI:170734519"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="GeneID:6124992"
FT                   /translation="MNTSTASADTAAERIRRRFGHFLHAAELAGLVVIGLATAFAMAQE
FT                   AWKVVLAGEVSLTDLLLMFLYLEVLAMDLRYLRLGRLPVRFPLFIAMTSLARDLILRGA
FT                   TDSPERMLMTTFGIVLLAVGVLILSFGQHRFPADVDDVEDDVHARK"
FT                   /protein_id="YP_001773633.1"
FT   misc_feature    872..>1006
FT                   /note="Phosphate-starvation-inducible E; Region: PsiE;
FT                   cl01264"
FT                   /db_xref="CDD:186407"
FT                   /locus_tag="Bcenmc03_6017"
FT   gene            1244..1699
FT                   /db_xref="GeneID:6124993"
FT                   /locus_tag="Bcenmc03_6018"
FT   CDS_pept        1244..1699
FT                   /locus_tag="Bcenmc03_6018"
FT                   /gene_family="HOG000268200" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7004 membrane protein"
FT                   /db_xref="GI:170734520"
FT                   /db_xref="GeneID:6124993"
FT                   /translation="MTRQLIVAVFGSVDTARQAANDFEALSEKNEGFHIENGVVVEKDA
FT                   NGKLAVLDAESRPFKGGVIGAIAGGLLGLLAGPIGMVTGMAAGAGAGILAQAAGNALLD
FT                   GTFVETVAARLVPGSVAVILEAKEDTPFSVDNVVTGFGGKVFRQALD"
FT                   /protein_id="YP_001773634.1"
FT   gene            1734..1982
FT                   /db_xref="GeneID:6124994"
FT                   /locus_tag="Bcenmc03_6019"
FT   CDS_pept        1734..1982
FT                   /locus_tag="Bcenmc03_6019"
FT                   /gene_family="HOG000268211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7005 hypothetical protein"
FT                   /db_xref="GI:170734521"
FT                   /db_xref="GeneID:6124994"
FT                   /translation="MRIDQSYRRFDIAATLSPLPGNRAIAIVDVTTDDPGRLADLGTGQ
FT                   FLQIRKWLESNDVALLTVVFDECKVAIDHYADNVDDA"
FT                   /protein_id="YP_001773635.1"
FT   gene            2361..3785
FT                   /db_xref="GeneID:6124995"
FT                   /locus_tag="Bcenmc03_6020"
FT   CDS_pept        2361..3785
FT                   /locus_tag="Bcenmc03_6020"
FT                   /gene_family="HOG000133006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_C7006 transcriptional
FT                   regulator GntR family with aminotransferase domain"
FT                   /db_xref="GI:170734522"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:6124995"
FT                   /translation="MKLYEKFANDVERLIRQGVYRHGDRVPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDGHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVAFATKADLPI
FT                   IENGVYNELYFGNMHPSTLKSFDRHDIVLHCSSFSKSLTAAYRIGWALPGRYREQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRVRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWVELPAQVDAMRLYQLALEQGITIGPGYMFSIADTYRNFIRLNYSSPWSPEI
FT                   ERAVVTVGKLAASCID"
FT                   /protein_id="YP_001773636.1"
FT   misc_feature    2361..3767
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    2364..2561
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    order(2364..2366,2370..2372,2439..2441,2445..2450,
FT                   2472..2486,2490..2495,2502..2504,2532..2537,2541..2552)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    2691..3746
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    order(2898..2906,2976..2978,3126..3128,3219..3221,
FT                   3300..3302,3306..3311,3330..3332)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    order(2907..2909,3006..3008,3198..3200,3324..3332,
FT                   3414..3416,3423..3425)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcenmc03_6020"
FT   misc_feature    3309..3311
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bcenmc03_6020"
FT   gene            complement(3813..4973)
FT                   /db_xref="GeneID:6124996"
FT                   /locus_tag="Bcenmc03_6021"
FT   CDS_pept        complement(3813..4973)
FT                   /locus_tag="Bcenmc03_6021"
FT                   /gene_family="HOG000136703" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formate dehydrogenase"
FT                   /transl_table="11"
FT                   /note="Catalyzes the reversible two-electron oxidation of
FT                   formate to carbon dioxide. It allows the assimilation of
FT                   carbon dioxide and provides energy for growth through
FT                   oxidative phosphorylation coupled to the reduction of
FT                   oxygen, nitrate, sulphate or fumarate"
FT                   /db_xref="GI:170734523"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="GeneID:6124996"
FT                   /translation="MATVLCVLYPDPVDGYPPRYVRDTIPVVTHYADGQTAPTPAGPPG
FT                   FRPGELVGSVSGALGLRGYMEAHGHTLIVTSDKDGPDSEFERRLPEADVVISQPFWPAY
FT                   LSAERIARAPKLKLALTAGIGSDHVDLDAAARAHITVAEVTGSNSISVAEHVVMTTLAL
FT                   VRNYLPSHAIAQQGGWNIADCVSRSYDVEGMHFGTVGAGRIGLAVLRRLQPFGLQLHYT
FT                   QRHRLDASIEQALALTYHADVASLASAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYL
FT                   INTARAKLVDRDAVVNALTSGHLAGYGGDVWFPQPAPADHPWRTMPFNGMTPHISGTSL
FT                   SAQARYAAGTLEILQCWFDGKPIRNEYLIVDGGTLAGTGAQSYRLT"
FT                   /protein_id="YP_001773637.1"
FT   misc_feature    complement(3816..4973)
FT                   /note="formate dehydrogenase; Provisional; Region:
FT                   PRK07574"
FT                   /db_xref="CDD:181041"
FT                   /locus_tag="Bcenmc03_6021"
FT   misc_feature    complement(3966..4505)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6021"
FT   gene            5206..6735
FT                   /db_xref="GeneID:6124997"
FT                   /locus_tag="Bcenmc03_6022"
FT   CDS_pept        5206..6735
FT                   /locus_tag="Bcenmc03_6022"
FT                   /gene_family="HOG000276711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_C7008 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:170734524"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:6124997"
FT                   /translation="MTGSDASSRPDLTQGIALDDLADGAMIEGHVGDAAVLLVRRADEL
FT                   FAVGAQCPHYGGPLAQGLLVGDTIRCPWHHAAFCLRTGEMERAPALDGLPCWRVERRDG
FT                   RAVVVDARPAAVPPALKETGLPSSVVIVGGGAAAIAAAVTLRQEGYPHAITLLSADADP
FT                   PYDRPNLSKDYLAGTAEADWLPLRAPSFYAGQRIDVRCNTRVTRIDPARRSVELADGSR
FT                   VEYGALLLATGAEPNRLNVPGADLPHVCTLRSRADCDALIAKLKTARRCVVVGASFIGL
FT                   EAAAALRTRGLDVHVVAPDPHPMGRVLGDALGDTIKALHEAHGVVFHLGTTPARIGPDN
FT                   VTLSNGDVLPADVVLVGIGVHPNVELAQEAGLAVERGVTVDRFLQTSAPGIYAAGDIAR
FT                   WPDPLTGERIRVEHWVVAERQGIVAARNLLGQQRPFDAVPFFWSQHYDLTLRYVGHAEQ
FT                   WDRVEIDGDLGAHDCSVAYWRGNTRLAVVTIARDLDNLKAEAALERQTASA"
FT                   /protein_id="YP_001773638.1"
FT   misc_feature    5242..5496
FT                   /note="AIFL (apoptosis-inducing factor like) family,
FT                   N-terminal Rieske domain; members of this family show
FT                   similarity to human AIFL, containing an N-terminal Rieske
FT                   domain and a C-terminal pyridine nucleotide-disulfide
FT                   oxidoreductase domain (Pyr_redox). The...; Region:
FT                   Rieske_AIFL_N; cd03478"
FT                   /db_xref="CDD:58548"
FT                   /locus_tag="Bcenmc03_6022"
FT   misc_feature    order(5359..5361,5365..5370,5416..5418,5425..5427,
FT                   5431..5433)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58548"
FT                   /locus_tag="Bcenmc03_6022"
FT   misc_feature    5638..>6495
FT                   /note="NAD(P)H-nitrite reductase [Energy production and
FT                   conversion]; Region: NirB; COG1251"
FT                   /db_xref="CDD:31443"
FT                   /locus_tag="Bcenmc03_6022"
FT   misc_feature    6019..6246
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bcenmc03_6022"
FT   gene            6778..7155
FT                   /db_xref="GeneID:6124998"
FT                   /locus_tag="Bcenmc03_6023"
FT   CDS_pept        6778..7155
FT                   /locus_tag="Bcenmc03_6023"
FT                   /gene_family="HOG000263268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7009 hypothetical protein"
FT                   /db_xref="GI:170734525"
FT                   /db_xref="GeneID:6124998"
FT                   /translation="MTPDVRARFETEFAPRIATRLRGLYQPGEVKVDVVPHDGQGSPTC
FT                   VDVIGLSSTVGLPNRLNARLAWRDDAIAGLLAEPDHSRFDRYLAALPVTIERWQMELPV
FT                   DFSSRTQRDREILIGDLDFDA"
FT                   /protein_id="YP_001773639.1"
FT   gene            complement(7205..7423)
FT                   /db_xref="GeneID:6124999"
FT                   /locus_tag="Bcenmc03_6024"
FT   CDS_pept        complement(7205..7423)
FT                   /locus_tag="Bcenmc03_6024"
FT                   /gene_family="HOG000268222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7010 hypothetical protein"
FT                   /db_xref="GI:170734526"
FT                   /db_xref="GeneID:6124999"
FT                   /translation="MQATDTFMGHEIRVDATRNANGAWVAQVRIFRDGAPVDLPAPELV
FT                   TPEWLTCDEALRGGIDQGRVIIRTRDR"
FT                   /protein_id="YP_001773640.1"
FT   gene            7546..8184
FT                   /db_xref="GeneID:6125000"
FT                   /locus_tag="Bcenmc03_6025"
FT   CDS_pept        7546..8184
FT                   /locus_tag="Bcenmc03_6025"
FT                   /gene_family="HOG000112971" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bur:Bcep18194_C7011 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="GI:170734527"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="GeneID:6125000"
FT                   /translation="MAFDLTFSIKVFAALFAIMNPIANIPVFLSLTEGAADGVRRKVAL
FT                   TAAIGVTVGCIVSAVAGGAILHVFGLTIDDFRLAGGLLVLLIALSMLHGAPSRQHAPGA
FT                   DEGADPAAADSVAIYPLTIPLLVGPGTIATMIVLGHGAVSSGQELAFALGLAAFLVLLA
FT                   VSLLSAPLIGHYLSPRVTAVTQRLMGMILAAIAMQMIVASLKAAFGLPH"
FT                   /protein_id="YP_001773641.1"
FT   misc_feature    7558..8157
FT                   /note="MarC family integral membrane protein; Region: MarC;
FT                   cl00919"
FT                   /db_xref="CDD:186259"
FT                   /locus_tag="Bcenmc03_6025"
FT   gene            8216..8686
FT                   /db_xref="GeneID:6125001"
FT                   /locus_tag="Bcenmc03_6026"
FT   CDS_pept        8216..8686
FT                   /locus_tag="Bcenmc03_6026"
FT                   /gene_family="HOG000268234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7012 hypothetical protein"
FT                   /db_xref="GI:170734528"
FT                   /db_xref="GeneID:6125001"
FT                   /translation="MNTLIVLSYPDLDAARRALAELGTLRDRHVVALAGVVIVECSTDG
FT                   QLRTHAVDPGRVSSGSLLDSVVAHVESSLDAWRERPVDDALTDRVARKARPGTVSLGLA
FT                   ATQLDIYALSAALAPLGGEVADTTLSIDDELKLVEAISNARDGSGERGPATD"
FT                   /protein_id="YP_001773642.1"
FT   misc_feature    8216..8662
FT                   /note="Protein of unknown function (DUF1269); Region:
FT                   DUF1269; cl01978"
FT                   /db_xref="CDD:154690"
FT                   /locus_tag="Bcenmc03_6026"
FT   gene            8826..10031
FT                   /db_xref="GeneID:6125002"
FT                   /locus_tag="Bcenmc03_6027"
FT   CDS_pept        8826..10031
FT                   /locus_tag="Bcenmc03_6027"
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bam:Bamb_5660 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="GI:170734529"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:6125002"
FT                   /translation="MKAVVFHGIGDIRIDTVPDPEVSATTDAVVRLTASAICGTDLHMV
FT                   RGTLGGMKPGTILGHEGVGIVEAVGRDVRNLRRGDRVLIPSTIACGSCAYCRAGYTAQC
FT                   DVANPGGPRAGTSFFGGPAETGPVDGLQAEYARTPLAHASLIRLPDAIDDDRAILMSDI
FT                   FPTGYFGAQLAEVKPGDTVAVFGAGPVGQFAIASAKLMGAGRVIAIDRIASRLEMACAQ
FT                   GAEIVDFSEDDPVDTVLRLTGGIGVDRVIDAVGVDAMRATHGPAAADRDAARAFDAEVD
FT                   AIVPHRKPDGRNWVPGDGPSQVLQWAVRAVAKAGTISVIGVYPPAARVFPIGEAMNRNL
FT                   TIKMGNCNHRTVTPPLVELVRSGAFDPLSVLTRTEPLTHAIDAYRAFDVREPGWMKVKL
FT                   AP"
FT                   /protein_id="YP_001773643.1"
FT   misc_feature    8826..10028
FT                   /note="Glutathione-dependent formaldehyde dehydrogenase
FT                   related proteins, child 1; Region: FDH_like_1; cd08283"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bcenmc03_6027"
FT   misc_feature    8826..10028
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="Bcenmc03_6027"
FT   misc_feature    order(8937..8945,8952..8954,9081..9083,9309..9311,
FT                   9321..9323,9378..9383,9387..9395,9450..9458,9468..9470,
FT                   9510..9512,9582..9590,9732..9734,9783..9791,9858..9866,
FT                   9984..9986)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bcenmc03_6027"
FT   misc_feature    order(8937..8939,8943..8945,9003..9005,9309..9311)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bcenmc03_6027"
FT   misc_feature    order(9093..9098,9102..9104,9111..9113,9135..9137)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bcenmc03_6027"
FT   gene            10067..10390
FT                   /db_xref="GeneID:6125003"
FT                   /locus_tag="Bcenmc03_6028"
FT   CDS_pept        10067..10390
FT                   /locus_tag="Bcenmc03_6028"
FT                   /gene_family="HOG000099005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   bvi:Bcep1808_5688 protein of unknown function DUF326"
FT                   /db_xref="GI:170734530"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="GeneID:6125003"
FT                   /translation="MTDQYDNCMAACDACAHACDTCAAACLAERDVHALATCIALDIEC
FT                   AQLCRFASGAMARRSGLAPRICALCAHACDLCAAECSRHAHEHCRRCALTCEACAAMCR
FT                   AMA"
FT                   /protein_id="YP_001773644.1"
FT   misc_feature    <10151..10357
FT                   /note="Cysteine-rich 4 helical bundle widely conserved in
FT                   bacteria; Region: DUF326; cd08026"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Bcenmc03_6028"
FT   misc_feature    order(10184..10189,10193..10198,10205..10210,10217..10219,
FT                   10226..10231,10247..10252,10259..10261,10271..10273,
FT                   10280..10285)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Bcenmc03_6028"
FT   gene            complement(10394..11983)
FT                   /db_xref="GeneID:6125004"
FT                   /locus_tag="Bcenmc03_6029"
FT   CDS_pept        complement(10394..11983)
FT                   /locus_tag="Bcenmc03_6029"
FT                   /gene_family="HOG000217841" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bmu:Bmul_5434 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein"
FT                   /db_xref="GI:170734531"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:6125004"
FT                   /translation="MKKDDADFPPHPPPGPPDARDLQHRFAEFRFQTVVESITDYAVFM
FT                   LDPYGNVATWNAGAERIKGYHAAEIVGHHFSLFYPIDAITAGRPSQGLALAAAHGHFED
FT                   EGWRVRKDGTQFWASVTITPVRDATHELCGFIKITRDMTERKRLEELEASTHRLSVFIA
FT                   MLAHELRNHLAPLRNSVGVLQNLPDPAPMLAQCRDAVNRQVAQLTRLVDDLLDVGRITA
FT                   GKVELDARPVSVRDIVCRGVESIQPKLAARGQWIRVDLPTDSVVLHGDDARLVQVLHNL
FT                   LDNASKFSPHGGRIDVGARIEGPMVAISVVDHGVGIAPGALETIFDLFEQEGATGRSPS
FT                   GGFGLGLAICRSFVELHGGRIVAESGGPGHGATFTVWLPIAQMARNEHTAPAAPAAPGQ
FT                   PAVEPLRIIIVDDNRDSADTLAVLLQLKGHAPRVAYDANEALALARDYAPQLMILDLTM
FT                   PDVDGFTLLQELRAIDALRDTTCVALSGHARASDLERTAQAGFDDHLVKPVEMAVLDVL
FT                   LQRVARQVQGTP"
FT                   /transl_table="11"
FT                   /protein_id="YP_001773645.1"
FT   misc_feature    complement(11558..11869)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(11645..11647,11660..11662,11741..11752,
FT                   11789..11791,11807..11809,11819..11821))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(10823..11773)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(11618..11620,11624..11626,11708..11713,
FT                   11723..11725,11747..11749,11759..11761))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(11327..11503)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(11342..11344,11354..11356,11363..11365,
FT                   11375..11377,11384..11386,11396..11398,11447..11449,
FT                   11456..11458,11468..11470,11477..11479,11489..11491,
FT                   11501..11503))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(11483..11485)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(10850..11164)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(10862..10864,10868..10873,10889..10891,
FT                   10895..10897,10943..10954,11033..11038,11042..11044,
FT                   11048..11050,11054..11056,11123..11125,11132..11134,
FT                   11144..11146))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(11132..11134)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(10946..10948,10952..10954,11036..11038,
FT                   11042..11044))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(10418..10762)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(10460..10465,10472..10474,10529..10531,
FT                   10595..10597,10619..10621,10748..10753))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(10619..10621)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(order(10595..10603,10607..10612))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6029"
FT   misc_feature    complement(10457..10465)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6029"
FT   gene            12241..12603
FT                   /db_xref="GeneID:6125005"
FT                   /locus_tag="Bcenmc03_6030"
FT   CDS_pept        12241..12603
FT                   /locus_tag="Bcenmc03_6030"
FT                   /gene_family="HOG000227225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5657 hypothetical protein"
FT                   /db_xref="GI:170734532"
FT                   /db_xref="GeneID:6125005"
FT                   /translation="MNSTLNPDNEPAGPDDDNASRGRDGRALGPSDSSDSGSDTAGARR
FT                   HPFDVDSPLDDHALERGDASLDSDTDRAGTGERASADGDSTLEEGADIEPDRTERLSEP
FT                   GRTDESEDLDEPGTAP"
FT                   /protein_id="YP_001773646.1"
FT   gene            12788..13672
FT                   /db_xref="GeneID:6125006"
FT                   /locus_tag="Bcenmc03_6031"
FT   CDS_pept        12788..13672
FT                   /locus_tag="Bcenmc03_6031"
FT                   /gene_family="HOG000268245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport-associated"
FT                   /transl_table="11"
FT                   /note="PFAM: transport-associated; KEGG: bam:Bamb_5656
FT                   transport-associated"
FT                   /db_xref="GI:170734533"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:6125006"
FT                   /translation="MQRRYPGRHGERGGPPDWRELNERAYRGAGERGIPDDPARWPEED
FT                   YESAYRRFASEDVGPEDWGSEWTERAARPADQRRAAADPDWPGGAREPARGAEHGYGDP
FT                   GRRAEGREGRYGGERPEYRGHHRMREYGGERDIGDPRGNPRGDSRGDPRYGGAPDLSRF
FT                   GPDTERDALRHRRGPKGYTRSDERIREDVCERLAHALEIDVSDVTVQVKAGRVELEGTV
FT                   PARWMKHDIEDLADGCLGVQDVENRVRVRRDDEPDAGMVLHPDQRTVTPTQPAARDPEP
FT                   GTVVGGREREPRH"
FT                   /protein_id="YP_001773647.1"
FT   misc_feature    13352..13507
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="Bcenmc03_6031"
FT   gene            13720..16521
FT                   /db_xref="GeneID:6125007"
FT                   /locus_tag="Bcenmc03_6032"
FT   CDS_pept        13720..16521
FT                   /locus_tag="Bcenmc03_6032"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter transmembrane region; response
FT                   regulator receiver; ABC transporter related; SMART: AAA
FT                   ATPase; KEGG: bam:Bamb_5655 response regulator receiver
FT                   protein"
FT                   /db_xref="GI:170734534"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="GeneID:6125007"
FT                   /translation="MTTGIDETPIKDREAAAGRDPRGRRDERGLRVRIAVELWRAIWHY
FT                   RTRVLAAIVLLVLAKAAAVSVPLLLKDIVDGFGRAAGQPMAWPVLLLFAYAVVRFASNA
FT                   LNEVRDMTFVQVTQHTVASFTVRTFGHLHRLGARFHAQRETGAVVRDLEKGTAGIGYLL
FT                   GVAVFTIVPTAIEIGSVLVIVISKYGGGFTAIIFVTFAVYAAYTVVFTRRRMRYQRRVN
FT                   ALEAESNSRVVDSLLNVDTVKYFAREDVERDRLDRVLDEWREAGVDNQYALSALHIGQS
FT                   ACIGAGIAAVMLLAGQQVARGAMTIGDLVLINAYIIQISLPLNALGFVFREANDAMTNI
FT                   ERLFGLLDARGKPGEDGDAPGAQPLVVRGGAIEFEHVDFGYEPSRQILFDVSFRIEPGQ
FT                   TIAVVGGSGSGKSTLARLLFRLYQPDAGTIRIDGQDLRLVTERSLRDALGIVPQDTILF
FT                   NDTLAYNIAYGKRDATRGEVIAAARGAQLDAFIERLPDAYDTRVGERGVRLSGGERQRV
FT                   AIARALLKAPPIVVFDEATSALDTRSERAIQQELMRVAQHRTSLVIAHRLSTIVDADRI
FT                   LVMEHGRLVEHGTHDELLESGGVYAQMWSLQAKQRELERTEAKFARQPVRINPLVSQVL
FT                   DSLAEAAARRGVPVFRHVSDEDLVVNADPAALRRFVWELCRGAIEASSGGQLEVHTARH
FT                   DPEARITIACTGVDATELSLIDLERLQDAIEEAGGYVVRERDDTGVTLHVSLPMYAVAP
FT                   ASMQPAGAVPNPAAGAAATARPLDGLRIACVDDHDEAREALGALLKMAGADVHAYASGQ
FT                   ALLDDLWRARRADWPALLVCDIDLGDDEDDGYAVMSRVRQLDAARDRDGRAPLEALALS
FT                   GHARDRDRTRAVEAGFHAYLTKPAVAADLIAALRALAFSSGEIHAEPSEPDDTRSPERA
FT                   SRR"
FT                   /protein_id="YP_001773648.1"
FT   misc_feature    13936..14688
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:186074"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    14044..15534
FT                   /note="ABC-type transport system involved in Fe-S cluster
FT                   assembly, permease and ATPase components [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: ATM1;
FT                   COG5265"
FT                   /db_xref="CDD:34862"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    14833..15540
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    14932..14955
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    order(14941..14946,14950..14958,15076..15078,15316..15321,
FT                   15412..15414)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    15067..15078
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    15244..15273
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    15304..15321
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    15328..15339
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    15400..15420
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    <15553..15837
FT                   /note="sensory histidine kinase CreC; Provisional; Region:
FT                   PRK11100"
FT                   /db_xref="CDD:182962"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    16066..16401
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    order(16072..16077,16216..16218,16246..16248,16330..16332,
FT                   16387..16389,16396..16401)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    16216..16218
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    order(16225..16230,16234..16239,16246..16248)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6032"
FT   misc_feature    16396..16401
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6032"
FT   gene            16547..16990
FT                   /db_xref="GeneID:6125008"
FT                   /locus_tag="Bcenmc03_6033"
FT   CDS_pept        16547..16990
FT                   /locus_tag="Bcenmc03_6033"
FT                   /gene_family="HOG000268256" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmu:Bmul_5438 hypothetical protein"
FT                   /db_xref="GI:170734535"
FT                   /db_xref="GeneID:6125008"
FT                   /translation="MAAVELLLPTLSAALQSDFVGDSGCLHIVIMDPALGPHDAAFEDA
FT                   ILYEFSLPDPKDWDADYRAYARAKARLSWETGRDGHVVQALEPYRLRAGDTNLWGGVAL
FT                   GGVVVGVSGAQPWFDEAFAGCIAHCLRALAKHRAQATPDALAI"
FT                   /protein_id="YP_001773649.1"
FT   gene            17188..17937
FT                   /db_xref="GeneID:6125009"
FT                   /locus_tag="Bcenmc03_6034"
FT   CDS_pept        17188..17937
FT                   /locus_tag="Bcenmc03_6034"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_5653 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:170734536"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:6125009"
FT                   /translation="MNATHDPAKPPLAGRTALVTGGGRGLGEAICEELAQHGAHVVVAD
FT                   LDGDRAAAVAQRLERHGGQAVGRPLDVRDEASVLQVVHDARESLGELDVIVNNAAIDVT
FT                   APIDDVSVDAWQQVLMTNLFGPYLMCHAAVPMMKARGNGHIVNIASTASKRAWPNASAY
FT                   HATKWGLLGLSHALHAELRPSGVRVSAIVAGGMRTPFLLDRFPDIDEDTLQPPEHVAAA
FT                   VRFVLTQPPGTVVPELMVLPMKETSWP"
FT                   /protein_id="YP_001773650.1"
FT   misc_feature    17215..17862
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Bcenmc03_6034"
FT   misc_feature    17221..17919
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6034"
FT   gene            17928..18539
FT                   /db_xref="GeneID:6125010"
FT                   /locus_tag="Bcenmc03_6035"
FT   CDS_pept        17928..18539
FT                   /locus_tag="Bcenmc03_6035"
FT                   /gene_family="HOG000016501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; histidinol-phosphate phosphatase family protein;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: bam:Bamb_5652
FT                   histidinol-phosphate phosphatase family protein"
FT                   /db_xref="GI:170734537"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="GeneID:6125010"
FT                   /translation="MALKRERRLPGAVLLDKDGTLLDDVPYNVDPARMRLAPGAARALR
FT                   TLGATGMPLAVVSNQPGVALGRFTENELGAVRQRLAELFEANGATLADFFYCPHHPRGS
FT                   VPRYTCDCICRKPRPGMLRRALSALGAVPEWSWMIGDILDDVEAGRTARCGTILVDCGN
FT                   ETEWQLNAARTPHHVVDRVDLAADIVVREAVRRHGSWVRR"
FT                   /protein_id="YP_001773651.1"
FT   misc_feature    17961..18404
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bcenmc03_6035"
FT   misc_feature    order(17973..17981,18099..18104)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bcenmc03_6035"
FT   misc_feature    17973..17990
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bcenmc03_6035"
FT   misc_feature    18099..18101
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bcenmc03_6035"
FT   gene            18536..19741
FT                   /db_xref="GeneID:6125011"
FT                   /locus_tag="Bcenmc03_6036"
FT   CDS_pept        18536..19741
FT                   /locus_tag="Bcenmc03_6036"
FT                   /gene_family="HOG000237542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bvi:Bcep1808_5696 glycosyl transferase, family 9"
FT                   /db_xref="GI:170734538"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:6125011"
FT                   /translation="MSTAWSRARRILCVRLDSIGDVLMTTPALRALKESGADRQLTLLT
FT                   SRTGAALAKHLPMVDDVWSYDAPWVKHPDVRGDPVADLDMIDRLLAGRFDAAVIFTVYS
FT                   QNPLPAAMMCWLAGIPLRLAHCRENPYELLTDRVPETEPESHVRHEVARQLALVRAVGA
FT                   KTSDWRMAFEPGDAARRAVHARLQAALQRVDGTRGLGATRARWMVVHPGATAASRRWPA
FT                   ERFGEAAAAVAPLFDGIAVTGGADERALVDAVCERAGPRAVPLAGVLPLGELGALIETA
FT                   DLLLSNNSGPVHLAAALGTPVVDLYALTNPQHTPWRVPHRVLNVDVPCRNCYRSVCNQP
FT                   GHPCLRGVSVDDVAAAVHALLRGRARHAQRAAERAAAHDEGEPVAAHASNVLPFAHVIT
FT                   RN"
FT                   /protein_id="YP_001773652.1"
FT   misc_feature    18560..19573
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bcenmc03_6036"
FT   misc_feature    18563..>18952
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bcenmc03_6036"
FT   misc_feature    18878..19573
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bcenmc03_6036"
FT   misc_feature    order(19160..19165,19259..19261,19355..19360,19394..19396,
FT                   19403..19408,19415..19417)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bcenmc03_6036"
FT   gene            19745..21490
FT                   /db_xref="GeneID:6125012"
FT                   /locus_tag="Bcenmc03_6037"
FT   CDS_pept        19745..21490
FT                   /locus_tag="Bcenmc03_6037"
FT                   /gene_family="HOG000268277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbamoyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyltransferase; KEGG: bam:Bamb_5650
FT                   carbamoyltransferase"
FT                   /db_xref="GI:170734539"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="GeneID:6125012"
FT                   /translation="MPESTYTLGINAAFHDSAACIVRDGVVIAAAEDERFTHVKHAKRP
FT                   VPFSTWELPFHAIDYCLAEAGITLADVDHVAYSYDPWFELDREGTAPALTLPLSPSAHA
FT                   PREDGASPWHPLFLSSIVNAPRQLAGGAPHHLQRRFRGVTHDGPFRWHFVEHHLAHEAS
FT                   AFLAAPFERCAVMTMDGRGERATTSYGVFDGRAYRRLGQVNLPHSLGLLYERLTRYLGF
FT                   LHSSDEYKVMALASYGKPVFADEMRKLVRYRGEGRYDVLDADLAALFGPARERGGPIEP
FT                   HHCDIAHALQLVLEETTLQAVDWLAAETGERQLAMAGGVALNCVMNARIRDRGPFDDVW
FT                   VQPAAGDAGTALGAALWTDFRMRGARGDWRMDHAYLGPAYDDDAIEAFLKEAQLPYRRL
FT                   ADVAAQTAALLAANRVIGWFQGRMEFGPRALGARSILASPIDPDMQQKLNRIKDREDFR
FT                   PVAPVVLEDRAHHWFSGGRRTPLRAPFMLFVYDVLPERAEKIPAVRHIDGTARVQTVDE
FT                   TQHPLLHALLTEFDALTGVPVLVNTSFNTRGEPIVCSPRDAIECFWTSPLDALVIGPFL
FT                   LEKPR"
FT                   /protein_id="YP_001773653.1"
FT   misc_feature    19757..21481
FT                   /note="Predicted carbamoyl transferase, NodU family
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG2192"
FT                   /db_xref="CDD:32375"
FT                   /locus_tag="Bcenmc03_6037"
FT   misc_feature    20228..21283
FT                   /note="Carbamoyltransferase; Region: CmcH_NodU; pfam02543"
FT                   /db_xref="CDD:111443"
FT                   /locus_tag="Bcenmc03_6037"
FT   gene            21487..22488
FT                   /db_xref="GeneID:6125013"
FT                   /locus_tag="Bcenmc03_6038"
FT   CDS_pept        21487..22488
FT                   /locus_tag="Bcenmc03_6038"
FT                   /gene_family="HOG000268278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bam:Bamb_5649 glycosyl transferase, family 2"
FT                   /db_xref="GI:170734540"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:6125013"
FT                   /translation="MNMRDTHLPPVVSVVVPTYRRPDLLERCLDALCVQVFDPTTYEIV
FT                   VVDDDPAGSARAVVDACRARVTDVPVIRYMTAPDTQGPAGARNVGWRSAGGALIAFTDD
FT                   DTIPDPTWLRHGAAALLAEPSASAAAGRIDVPLRPRPTDYERDAAGLAQAEFATANCFV
FT                   RRAALERIGGFDERFTRAWREDADLMFALREHAGPIVEADAARIVHPVRPARWGSSIGA
FT                   QSKVYFDALLYKKHRTTYRRHIRPTPPWHYYAAVLAALGAIGCFAAGWPAPAIVCAAVW
FT                   AAITAGFCAKRLRGTQLTPSHVAEMIVTSIAIPPVSLYWRMRGALHFRVLFL"
FT                   /protein_id="YP_001773654.1"
FT   misc_feature    21526..22071
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Bcenmc03_6038"
FT   misc_feature    order(21535..21537,21541..21543,21625..21627,21793..21795,
FT                   21799..21801)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Bcenmc03_6038"
FT   gene            complement(22502..23554)
FT                   /db_xref="GeneID:6125014"
FT                   /locus_tag="Bcenmc03_6039"
FT   CDS_pept        complement(22502..23554)
FT                   /locus_tag="Bcenmc03_6039"
FT                   /gene_family="HOG000125069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS605 family transposase OrfB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: bam:Bamb_3435 transposase,
FT                   IS605 OrfB family"
FT                   /db_xref="GI:170734541"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="GeneID:6125014"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWNKKWP
FT                   TGFDLNVLTTGSSKELGIHSGTVNATCEQYAKSRSQHRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEDKIKDGTNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDRFGRRAAEKLAKAQRARKHKRHIAKLHAKIANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAAKLARTRMAKSAYDASWSSFRNKLRYKAIAHGATF
FT                   EEVDESGSTQSCSSCGSKDSTTRPKGIAGLRIREWACSDCGVEHDRDTNTAVNILRCGR
FT                   ASPGVGIISL"
FT                   /protein_id="YP_001773655.1"
FT   misc_feature    complement(22802..>23134)
FT                   /note="Probable transposase; Region: Transposase_2;
FT                   pfam01385"
FT                   /db_xref="CDD:144832"
FT                   /locus_tag="Bcenmc03_6039"
FT   misc_feature    complement(22544..22768)
FT                   /note="Putative transposase DNA-binding domain; Region:
FT                   Transposase_35; pfam07282"
FT                   /db_xref="CDD:115907"
FT                   /locus_tag="Bcenmc03_6039"
FT   gene            23644..24732
FT                   /db_xref="GeneID:6125015"
FT                   /locus_tag="Bcenmc03_6040"
FT   CDS_pept        23644..24732
FT                   /locus_tag="Bcenmc03_6040"
FT                   /gene_family="HOG000237543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bam:Bamb_5648 glycosyl transferase, family 9"
FT                   /db_xref="GI:170734542"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:6125015"
FT                   /translation="MKLDSSVDSDGPRGPKRIAVFRALQLGDMLCAVPALRALRRGEPD
FT                   ARITLIGLPWAREFASRFSDYIDSFIAFPGAPGLGEQPEPDAATREAFIAECRSRDFDL
FT                   AIQLHGSGAHTNAIVASLGATRTAGFVPADGGTTALDCALVWRDDEPEVTRYLVLTRQL
FT                   GYADWGDYLEFPLGGLDYALWHVLCDEHALDPGRYVIVHPGARMASRRWPIERFAQAAR
FT                   QLADDGWQIVLTGTRAELALASAFAEHLGRPCVNLCGRTPLGALAALIARARLLLCNDT
FT                   GVSHVAAALGTPSIVVACGSDTARWAPLDTERHHVLANYPPCRPCMFDTCPYGHECATA
FT                   IGVGDVIGRAGELLAEERRHVT"
FT                   /protein_id="YP_001773656.1"
FT   misc_feature    23686..24717
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bcenmc03_6040"
FT   misc_feature    23692..24693
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bcenmc03_6040"
FT   misc_feature    order(24244..24249,24343..24345,24439..24444,24478..24480,
FT                   24487..24492,24499..24501)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bcenmc03_6040"
FT   gene            24722..25672
FT                   /db_xref="GeneID:6125016"
FT                   /locus_tag="Bcenmc03_6041"
FT   CDS_pept        24722..25672
FT                   /locus_tag="Bcenmc03_6041"
FT                   /gene_family="HOG000237554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bam:Bamb_5647 glycosyl transferase, group 1"
FT                   /db_xref="GI:170734543"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:6125016"
FT                   /translation="MSRKRLRVLTWHVHGNYLYYLSQAPHDFYIVTKPQHPPGYAGRVG
FT                   HLPWGDNVHEVPAECVRDTEFDCVLYQHAKHYQHDRLRLLSEAQRALPTLFVEHDPPRE
FT                   HPTDTLHPVQDPNVLLVHVTPFNALMWDNGVTPTRVIEHGVLMPEGVEYHGTLPKGVAV
FT                   VNNLARRGRRLGADLFEVVRHSVPIDLVGMGSSELGGIGEVPNPALPQFLSHYRFFFNP
FT                   IRYTSLGLAVIEAMMIGLPIVALATTEMAQLVKTGSNGVADTRPAVLIDAMRMLIRDPE
FT                   LAREWGAAAKRDACERFGIARFARDWDAALRDVTG"
FT                   /protein_id="YP_001773657.1"
FT   misc_feature    <25322..25657
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bcenmc03_6041"
FT   gene            complement(25710..26744)
FT                   /db_xref="GeneID:6125017"
FT                   /locus_tag="Bcenmc03_6042"
FT   CDS_pept        complement(25710..26744)
FT                   /locus_tag="Bcenmc03_6042"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-54 dependent trancsriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bam:Bamb_5646 sigma54 specific transcriptional regulator,
FT                   fis family"
FT                   /db_xref="GI:170734544"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:6125017"
FT                   /translation="MSKSDDDGTRLFGRSRTIQDLLLKVSRVAATRVSVLVVGESGAGK
FT                   DIVARLIHDMSPRRRGPFVPVNCGAIPKDIAESQLFGHEKGSFTGAVAQHVGMFEAARG
FT                   GTLFLDEIAEMPLELQVKLLRTLETNTIVRVGGHEAIPLDVRIVAATHHDPVEALRSGA
FT                   LREDLFYRIAPIALHVPALRQREDDVGDIAVQIVERLNARHRTRKRLSTQAMKALRAYT
FT                   WPGNVRELRNTLERAFILADEQIELQLPRRPPPREEVRHNAMTLHIGTTLAHTQQRFIV
FT                   ASLRHFNGDKPRTAKALGISLKTLYNRLALLPESERNAVTGSAPPNAANGGGNAPASPP
FT                   ATTP"
FT                   /protein_id="YP_001773658.1"
FT   misc_feature    complement(26229..26711)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(26229..26645)
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(26607..26630)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(order(26289..26291,26415..26417,26604..26627))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(26412..26429)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(26232..26234)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6042"
FT   misc_feature    complement(25818..>25907)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Bcenmc03_6042"
FT   gene            27076..28443
FT                   /db_xref="GeneID:6125018"
FT                   /locus_tag="Bcenmc03_6043"
FT   CDS_pept        27076..28443
FT                   /locus_tag="Bcenmc03_6043"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component, sigma54 specific, Fis family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: bmu:Bmul_5447
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="GI:170734545"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:6125018"
FT                   /translation="MPYVLIVEDDADTRTMLATLARTQQLTCDTAATLEEARTLVSTHT
FT                   PDLVLCDLVLPDGNGMDLFDALPKRAHCEMVLTTGHASLETAIDALRRGATDYLVKPLN
FT                   MQRLNSIFARVPRTTALHEEIAELRSELQRLGRFGRMLGSSPAMQAVYDAIGRVARTEA
FT                   SVLLTGESGTGKELAAQTVHDLSLRRRGPFLAVNCGAIAANLVESEMFGHDRGSFTGAE
FT                   RQHKGFFERADGGTLFLDEITEMPLESQVKLLRVLETGRVTRLGSTREIDVDVRIVAAT
FT                   NRDPEAAMADGKLRPDLFHRINVFPIPLPSLRERGDDIPMLADAFLQRYNEESGRNLRF
FT                   APAAREALKTYEWPGNVRELRNFVQRASIFTDADVIETLPPPIMDELSSMVDSHEDRVT
FT                   VPFGTPLEEVDRKLILGTIAQCGGVKAQAAEVLDVSLKTIYNRLAQLEDEAEKPDS"
FT                   /protein_id="YP_001773659.1"
FT   misc_feature    27076..28437
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27088..27399
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    order(27097..27102,27229..27231,27253..27255,27310..27312,
FT                   27367..27369,27376..27381)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27229..27231
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    order(27238..27243,27247..27255)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27376..27384
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27511..27984
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27580..27603
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    order(27583..27606,27793..27795,27919..27921)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27781..27798
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    27976..27978
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcenmc03_6043"
FT   misc_feature    28291..28413
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Bcenmc03_6043"
FT   gene            complement(28461..29384)
FT                   /db_xref="GeneID:6125019"
FT                   /locus_tag="Bcenmc03_6044"
FT   CDS_pept        complement(28461..29384)
FT                   /locus_tag="Bcenmc03_6044"
FT                   /gene_family="HOG000268289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bam:Bamb_5644 glycosyl transferase, family 2"
FT                   /db_xref="GI:170734546"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:6125019"
FT                   /translation="MRLHVRVTPACVALPPGEPRVTAIVLTCRRAAELARTLEHLSVLP
FT                   DRPAIVVVDNAADADTATLIHDRFPHVALVHAPGNLGAAGRNLGVAVARTRHVAFCDDD
FT                   TWWAPGSIAEAANLLDAYPHVAAVTARVLVGPDEREDPTCRLMADSPLDAPVALPGRPI
FT                   LGLLAGATAFRRDAFVRAGGYHPHYFLGGEEALLALDLYRAGHWLVYAPRLTVHHYPSM
FT                   QRDRPTRARTAARNAVWTAWLRWPATAAWQHTLRMLPLLHRERAIVRTFAGLPWTLRER
FT                   RTIPPHVERMRRRLERDTRPEAGTET"
FT                   /protein_id="YP_001773660.1"
FT   misc_feature    complement(28728..>29186)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:187019"
FT                   /locus_tag="Bcenmc03_6044"
FT   gene            complement(29363..30058)
FT                   /db_xref="GeneID:6125020"
FT                   /locus_tag="Bcenmc03_6045"
FT   CDS_pept        complement(29363..30058)
FT                   /locus_tag="Bcenmc03_6045"
FT                   /gene_family="HOG000268300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LmbE family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LmbE family protein; KEGG: bam:Bamb_5643
FT                   hypothetical protein"
FT                   /db_xref="GI:170734547"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="GeneID:6125020"
FT                   /translation="MPDPTRWLVVSPHLDDAVFSCGQLLAQAPGSIVVTVFAGIPPPGT
FT                   PAPPWDQRAGFRHADEAMRARRDEDRRALALVGARPVWLDFLDDQYRIPTTPTAIATRV
FT                   AEAIDAHPGFGVLAPAGLFHRDHLQVQEAMLWLLRDDDPSHVWRFYEDVPYRRIDGLMA
FT                   RRVSEWRERGWTAHPVAASAAGDTQGVAAKAAAVDAYASQVTLLEPHMRAALREPETIW
FT                   KLECDFTSA"
FT                   /protein_id="YP_001773661.1"
FT   gene            30178..32484
FT                   /db_xref="GeneID:6125021"
FT                   /locus_tag="Bcenmc03_6046"
FT   CDS_pept        30178..32484
FT                   /locus_tag="Bcenmc03_6046"
FT                   /gene_family="HOG000187353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7014 multi-sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="GI:170734548"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:6125021"
FT                   /translation="MTEIARPQAGNYATAVMLVAIATVLQTLAIRFGGVNLPFVLYYPL
FT                   LAGAAWATSFVFGIVSTVVSGLLVWTLFLSDPAAYTAPLPDRLVQLGTFILIGALVCAI
FT                   ASLLHHTRLTNDRARRREAATRRQFEAVLRALPHGVIATDPNGRLTYLNAAAAELVGCR
FT                   PDEAVGRPVRDVLRIVDHEGRRVPTTPLDHALGGAEATSDRHWLQAGSGEPVPIVAVAS
FT                   PIGDADGNLDGAVLLLRDAGADRARVDASRLQHAVVEASPDAIVGIDASGRIASWNAAA
FT                   QRIFGYDEADARGRRFDTLIARRWLRLNPLADAFDAMQEPVGPLELLCVRRDGRRFRAT
FT                   VSACPVQGDARAYVALSLTLRETGAQRRRDLRAQRSLQGARDARDQADTSNRLKDELLA
FT                   TVSHELRTPLNVIYGWIEVLRNTGDHALQHQAVDAIDRSARSLTRMVGDILDASSLATG
FT                   KLRLDATPVDVVRLFSDQVGTFQTAASSAGILLEFDCDASACIVSGDAERLRQMLSNLI
FT                   SNALKFTPGGGSVTVGLARDGGHAVLTVADTGQGIATEFTPYVFDMFRRADDSPASPRR
FT                   GLGLGLSIVRHIAQLHGGSVTVASAGRDRGTTFTVTLPAGWQPGGAMAWSIVQAGGQRE
FT                   ALVLDTQRILIVDDDATTRASLTAALTTFGAAVAIASSGREALAMVADMRPTVVLSDLA
FT                   MPDGDGFWLLEALRRATTNGDSGPLDVRVLAVTAHAGLADERRALEAGFDGYLCKPVDV
FT                   RELAHKIAHVTKRDG"
FT                   /protein_id="YP_001773662.1"
FT   misc_feature    30559..30867
FT                   /note="PAS fold; Region: PAS; pfam00989"
FT                   /db_xref="CDD:144544"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    30583..30867
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(30631..30633,30643..30645,30661..30663,30700..30711,
FT                   30796..30798,30811..30813)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(30691..30693,30703..30705,30727..30729,30745..30750,
FT                   30832..30834,30838..30840)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    30928..32016
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    30940..>31086
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    31348..31536
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(31366..31368,31378..31380,31390..31392,31399..31401,
FT                   31411..31413,31420..31422,31468..31470,31480..31482,
FT                   31489..31491,31501..31503,31510..31512,31522..31524)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    31384..31386
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    31702..32016
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(31720..31722,31732..31734,31741..31743,31810..31812,
FT                   31816..31818,31822..31824,31828..31833,31912..31923,
FT                   31969..31971,31975..31977,31993..31998,32002..32004)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    31732..31734
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(31822..31824,31828..31830,31912..31914,31918..31920)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    32110..32466
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(32119..32124,32251..32253,32275..32277,32356..32358,
FT                   32413..32415,32422..32427)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    32251..32253
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    order(32260..32265,32269..32277)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6046"
FT   misc_feature    32422..32430
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6046"
FT   gene            complement(32525..33571)
FT                   /db_xref="GeneID:6125022"
FT                   /locus_tag="Bcenmc03_6047"
FT   CDS_pept        complement(32525..33571)
FT                   /locus_tag="Bcenmc03_6047"
FT                   /gene_family="HOG000168004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: bmu:Bmul_5451 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:170734549"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:6125022"
FT                   /translation="MKGYDRKRVLVTGGAGFLGSHLCERLVTAGHDVLCVDNFYTGTKD
FT                   NIAHLLDAPNFELMRHDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINL
FT                   LGLAKRVKARILQASTSEVYGDPDVHPQDEHYCGRVNPTGIRACYDEGKRCAETLFADY
FT                   HRQYGIDVRIARIFNTYGPRMHPADGRVVSNFVTQALAEQPLTVYGDGKQTRSFCYVDD
FT                   MVDALIRLMDEPGDTSEPVNLGSDVEIAMIDVAREVVRIVGANVPIEFRPLPSDDPRQR
FT                   RPNLAAAQKRLGWRATTTFANGLAHTARYFIQRQVTHHAPGDLVRSTRIASHLLAQVHT
FT                   QNRPAPTT"
FT                   /protein_id="YP_001773663.1"
FT   misc_feature    complement(<33461..33571)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6047"
FT   misc_feature    complement(32588..>33565)
FT                   /note="UDP-glucuronate decarboxylase; Region: PLN02206"
FT                   /db_xref="CDD:177856"
FT                   /locus_tag="Bcenmc03_6047"
FT   misc_feature    complement(<32855..>33007)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6047"
FT   gene            complement(33571..34890)
FT                   /db_xref="GeneID:6125023"
FT                   /locus_tag="Bcenmc03_6048"
FT   CDS_pept        complement(33571..34890)
FT                   /locus_tag="Bcenmc03_6048"
FT                   /gene_family="HOG000077288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bvi:Bcep1808_5707 glycosyl transferase, group 1"
FT                   /db_xref="GI:170734550"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:6125023"
FT                   /translation="MQRIALISEHASPLGVIGGVDAGGQNIYVANVAKQLAERGLDVDV
FT                   YTRCDNPHLPEVVSIGPRMRVIHVPAGPPTDVPKEQLLPYMSPFAQYMIARMRREPDPV
FT                   DVMHANFFMSGDAALRVKKALGIPLVTTFHALGRVRRLHQGTADGFPDARFTIEDTLAR
FT                   RSDRLIAECPQDALDLTTHYRADTARIEIVPCGFDAREFRPVPRVDARARLGWPQDAFV
FT                   VLQLGRLVPRKGIDTVIDALARMPRDPQRPTHLYVVGGSQPTPDPARDPELARLAAFAH
FT                   ELGIANRVTFVGRRDRDTLHLYYSAADVFVTTPWYEPFGITPVEAMACAAPVIGSDVGG
FT                   IRTTVDDGTTGYLVPPRDPAALAARLVQLRAQPDLCAALGRAGYLRAHRFYTWQGVADR
FT                   LVDIYRDVAHAQRAGTSAGTGRRTPVATTRGVLAHRKENA"
FT                   /protein_id="YP_001773664.1"
FT   misc_feature    complement(33685..34884)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. The sucrose-phosphate
FT                   synthases in this family may be unique to plants and
FT                   photosynthetic bacteria. This enzyme catalyzes the
FT                   synthesis of sucrose 6-phosphate from fructose...; Region:
FT                   GT1_Sucrose_synthase; cd03800"
FT                   /db_xref="CDD:99973"
FT                   /locus_tag="Bcenmc03_6048"
FT   misc_feature    complement(33661..34881)
FT                   /note="UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate
FT                   1-alpha-D-N-acetylglucosaminyltransferase; Region:
FT                   mycothiol_MshA; TIGR03449"
FT                   /db_xref="CDD:132490"
FT                   /locus_tag="Bcenmc03_6048"
FT   misc_feature    complement(order(33925..33927,33991..33993,34207..34215,
FT                   34819..34821))
FT                   /note="putative ADP-binding pocket; other site"
FT                   /db_xref="CDD:99973"
FT                   /locus_tag="Bcenmc03_6048"
FT   gene            35135..35539
FT                   /db_xref="GeneID:6125024"
FT                   /locus_tag="Bcenmc03_6049"
FT   CDS_pept        35135..35539
FT                   /locus_tag="Bcenmc03_6049"
FT                   /gene_family="HOG000130654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport-associated"
FT                   /transl_table="11"
FT                   /note="PFAM: transport-associated; KEGG: bam:Bamb_5639
FT                   transport-associated"
FT                   /db_xref="GI:170734551"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:6125024"
FT                   /translation="MKVSPLQGRSPRIRRQRALRTGMAVAIAAAAACMVVAPNAVAAGD
FT                   DGTASSSTSSSHSSTGTKIRDATITTKAKAELVGTSGLSAGDIHVKTRHGTVTLTGSVL
FT                   DEQQRTQAVSVVKQVDGVQDVRDQLTIRPK"
FT                   /protein_id="YP_001773665.1"
FT   misc_feature    35342..35533
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="Bcenmc03_6049"
FT   gene            35570..36598
FT                   /db_xref="GeneID:6125025"
FT                   /locus_tag="Bcenmc03_6050"
FT   CDS_pept        35570..36598
FT                   /locus_tag="Bcenmc03_6050"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_5638 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:170734552"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:6125025"
FT                   /translation="MNCMLKPVGEQTIVITGATSGIGLVTARKAARRGAKLVLFARNEE
FT                   ALNTLCEEIRQHGGLAVPVAGDVGNVEDLQRAAAAAADTYGGFDTWINNAGVSIFGTAA
FT                   QVPLEDQRRLFDTNYWGVVHGSLVAADHFRRKSDFHGGAIINMGSEASDAPVPLQSAYV
FT                   ASKHAVKGFTDSLRLEMEADHLPVSVTLIKPAAIDTMFVMHAKNYMNVEAKLPPPIYDP
FT                   DLVADAILFAAAHPRRTLFVGGAAKLTSASAYHAPRLFDRLAATLFSRGQRTVRPARPR
FT                   DDNALYDSRHALHEREGMEGPVLRSCAYNSVVQRPKVAGAVALGAAALVFAAFARARRQ
FT                   SA"
FT                   /protein_id="YP_001773666.1"
FT   misc_feature    35576..36523
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6050"
FT   misc_feature    35600..36379
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="Bcenmc03_6050"
FT   gene            36626..36925
FT                   /db_xref="GeneID:6125026"
FT                   /locus_tag="Bcenmc03_6051"
FT   CDS_pept        36626..36925
FT                   /locus_tag="Bcenmc03_6051"
FT                   /gene_family="HOG000266268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmu:Bmul_5455 hypothetical protein"
FT                   /db_xref="GI:170734553"
FT                   /db_xref="GeneID:6125026"
FT                   /translation="MTSRQHTGHEYSHSRAHEGERTQQDHDKGGHQAGHGKPPSPVDVQ
FT                   KALKGMDYPASKSDVVQCAERSHADPAVLDMLRKIPEREYDTPASISKELGRLM"
FT                   /protein_id="YP_001773667.1"
FT   misc_feature    36767..36898
FT                   /note="Protein of unknown function (DUF2795); Region:
FT                   DUF2795; pfam11387"
FT                   /db_xref="CDD:151827"
FT                   /locus_tag="Bcenmc03_6051"
FT   gene            36987..37553
FT                   /db_xref="GeneID:6125027"
FT                   /locus_tag="Bcenmc03_6052"
FT   CDS_pept        36987..37553
FT                   /locus_tag="Bcenmc03_6052"
FT                   /gene_family="HOG000187464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmu:Bmul_5456 hypothetical protein"
FT                   /db_xref="GI:170734554"
FT                   /db_xref="GeneID:6125027"
FT                   /translation="MAMIVAGRFTTFDEAEGGARHLYERAFGPDDVSIFFLNPGGQHAR
FT                   FPIGGDVYADTAAKPGGRGAMVGAMRGLLIGVVIGLIAYALGLRYWFVPAAAALAGAYL
FT                   GAFGGALGRMRGEQAEGKGTLAQSETGVILAARVTPDTATAAEDVLRATGAKSIERVEG
FT                   DWQDGEWRDFDPVRRPDEAPSGGPR"
FT                   /protein_id="YP_001773668.1"
FT   gene            37675..38532
FT                   /db_xref="GeneID:6125028"
FT                   /locus_tag="Bcenmc03_6053"
FT   CDS_pept        37675..38532
FT                   /locus_tag="Bcenmc03_6053"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bmu:Bmul_5457 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="GI:170734555"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:6125028"
FT                   /translation="MTTAQTPPPQKQTQQPGTERDMHPKPRDEAADYVGSGKLAGKVAL
FT                   VTGGDSGIGRAVAVGFAKEGADVSIVYLKESDDAAHTKQLIEQAGRRCEAIACDVGDRR
FT                   QARDAVARTVERLGRLDVLVNNAGEQHPQPGIEDVSEEQLERTFRTNVYGMFFCTQAAL
FT                   PHMKEGGRIVNTASVTAYHGSPKLPDYSATKGAIVAFTRSLSIELAERDIRVNAVAPGP
FT                   IWTPLIPSTFTPEQVAKFGSNVPLKRPGQPDELIDCYVLLASDGASYMTGQTLHPNGGS
FT                   IVGG"
FT                   /protein_id="YP_001773669.1"
FT   misc_feature    37729..38529
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK06701"
FT                   /db_xref="CDD:180661"
FT                   /locus_tag="Bcenmc03_6053"
FT   misc_feature    37780..38514
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bcenmc03_6053"
FT   gene            38567..39181
FT                   /db_xref="GeneID:6125029"
FT                   /locus_tag="Bcenmc03_6054"
FT   CDS_pept        38567..39181
FT                   /locus_tag="Bcenmc03_6054"
FT                   /gene_family="HOG000187685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5634 hypothetical protein"
FT                   /db_xref="GI:170734556"
FT                   /db_xref="GeneID:6125029"
FT                   /translation="MGQPHWTIAALAAGVLAVSGLARAQMPSEPPASNAHVPGGVINPS
FT                   SGAGAAGDPGIAKAPKGTDAEFVDKAAMAGKAEVQASQLALKQAQSADVRAFAKRMVAD
FT                   HGKANAKLNEIAARKGIKPQVEQISDPDVKALRGKSGHDFDTAYLAAAGPDAHQKAVAL
FT                   FEDEARDGKDAQLRAFAQSTLPTLKHHLSMAQTLARKVGTQ"
FT                   /protein_id="YP_001773670.1"
FT   misc_feature    38753..39160
FT                   /note="Predicted outer membrane protein [Function unknown];
FT                   Region: COG3652"
FT                   /db_xref="CDD:33450"
FT                   /locus_tag="Bcenmc03_6054"
FT   gene            39241..39852
FT                   /db_xref="GeneID:6125030"
FT                   /locus_tag="Bcenmc03_6055"
FT   CDS_pept        39241..39852
FT                   /locus_tag="Bcenmc03_6055"
FT                   /gene_family="HOG000268311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5714 hypothetical protein"
FT                   /db_xref="GI:170734557"
FT                   /db_xref="GeneID:6125030"
FT                   /translation="MAQRQSKHEGILELLCQAYETELGGAQIYEAALQCATDEDLHKEW
FT                   EKYHRETLHHQEVLRKVFETLGLDPDAQSPGRAAVAATGKSLVQVIQQAKKQADPAVAQ
FT                   VVAAECVVLAETKDHLNWELIGYAADQLPDSDAAKALKAAHDEVEADEDHHLYHTRGWA
FT                   REMWIESMGFKAVLPPPEEVKKVESAADAARAERSRGKMM"
FT                   /protein_id="YP_001773671.1"
FT   gene            complement(39949..41241)
FT                   /db_xref="GeneID:6125031"
FT                   /locus_tag="Bcenmc03_6056"
FT   CDS_pept        complement(39949..41241)
FT                   /locus_tag="Bcenmc03_6056"
FT                   /gene_family="HOG000267728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5716 natural
FT                   resistance-associated macrophage protein"
FT                   /db_xref="GI:170734558"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="GeneID:6125031"
FT                   /translation="MSGLDEDAQPAAEAPPAAAKPWYRRLGPGLLAGASDADPSNVAVY
FT                   AQAGSQFGFNMLWMIVVTLPMMVAVQLASAFIGRRNREGLVAGIRQHYSEHVAKMLIGM
FT                   VVIVNVVNVGADLAAMGDATALVVGGRSYWYAPLYGIASLALQVMLSYERYARWLKWMT
FT                   LGLVAYVLELGFVHVDWGDLLHAIVLPHIAFTHDYATTAVAVLGTTLSPYLFVWQAALE
FT                   VEETTAEQQNGERNSRRETEQRITFDTWTGMIVTNAVSFCIMVIGAAVFFAHGRHDIGS
FT                   TAKAAEALRPIAGEAAFVVFAFGIVGCGLLAIPAFAGSAAYGCAEAWRFREGLNEPVRR
FT                   APAFYTVLALCVIVGIAICFSPIDPIRALYWSAVLNGVAAVPMLVLVMLLSQKRDAAGQ
FT                   PGSGPVSKVFGWLAVALMAVSVVTMIVDVLT"
FT                   /protein_id="YP_001773672.1"
FT   misc_feature    complement(40111..41118)
FT                   /note="Natural resistance-associated macrophage protein;
FT                   Region: Nramp; cl00836"
FT                   /db_xref="CDD:186214"
FT                   /locus_tag="Bcenmc03_6056"
FT   gene            complement(41238..41909)
FT                   /db_xref="GeneID:6125032"
FT                   /locus_tag="Bcenmc03_6057"
FT   CDS_pept        complement(41238..41909)
FT                   /locus_tag="Bcenmc03_6057"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   bam:Bamb_5631 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="GI:170734559"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:6125032"
FT                   /translation="MTRKTPDRPAPTQQPPDDDAPATLDACRRCALWEHATQPVPGAGP
FT                   VDAPIMLVGEQPGDQEDRAGLPFVGAAGRMLDRALDEAGIERAQVYLTNAVKHFKWEPR
FT                   GKRRLHKTPAQREVAACHYWLERELQAVQPRLVVALGATALRAVLQDNDATLERTRAPV
FT                   RTEDGRLVVATYHPSYVLRTRGADSREHAYRTLVDALRTASRLARERRHGGGRPAHGDA
FT                   G"
FT                   /protein_id="YP_001773673.1"
FT   misc_feature    complement(41364..41831)
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:186027"
FT                   /locus_tag="Bcenmc03_6057"
FT   gene            42143..42622
FT                   /db_xref="GeneID:6125033"
FT                   /locus_tag="Bcenmc03_6058"
FT   CDS_pept        42143..42622
FT                   /locus_tag="Bcenmc03_6058"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bam:Bamb_5630 response regulator receiver protein"
FT                   /db_xref="GI:170734560"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:6125033"
FT                   /translation="MQLDPGDDPAADDVLLWRAPDSVPRRPRRVLVVDDYRDAADALRL
FT                   LLEARGFECRVADDPFAVCDVARDWQPFAVVLDIAMPGLDGLQLAARLRRDPRTSDMLL
FT                   IACSGLASRRDCERAKEAGFDAHCAKPLTPHRLLGYLESASGGARKPDGDVTRAL"
FT                   /protein_id="YP_001773674.1"
FT   misc_feature    42293..42574
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6058"
FT   misc_feature    order(42374..42376,42398..42400,42464..42466,42521..42523,
FT                   42530..42535)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6058"
FT   misc_feature    42374..42376
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6058"
FT   misc_feature    order(42383..42388,42392..42400)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6058"
FT   misc_feature    42530..42538
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcenmc03_6058"
FT   gene            complement(42755..43237)
FT                   /db_xref="GeneID:6125034"
FT                   /locus_tag="Bcenmc03_6059"
FT   CDS_pept        complement(42755..43237)
FT                   /locus_tag="Bcenmc03_6059"
FT                   /gene_family="HOG000187796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PRC-barrel domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bam:Bamb_5622
FT                   PRC-barrel domain protein"
FT                   /db_xref="GI:170734561"
FT                   /db_xref="InterPro:IPR007903"
FT                   /db_xref="GeneID:6125034"
FT                   /translation="MQTPDQGQTRIIGKGAATAAGPGPDVMAADTLEGDKVYTTDGDDV
FT                   GKIKDIMLDVRSGRIAYAVLSSGGILGIGDKLHAIPWSALTLDTERKCFLLSVSSERIR
FT                   NAPGFDKDHWPAMADPQWAEPLHEFYGSTPYWSAGDELGLTDPTEDLDDPRTRGRH"
FT                   /protein_id="YP_001773675.1"
FT   misc_feature    complement(42962..43165)
FT                   /note="Photosynthetic reaction center (RC) complex, subunit
FT                   H;  RC is an integral membrane protein-pigment complex
FT                   which catalyzes light-induced reduction of ubiquinone to
FT                   ubiquinol, generating a transmembrane electrochemical
FT                   gradient of protons used to...; Region: PRCH; cl09959"
FT                   /db_xref="CDD:164180"
FT                   /locus_tag="Bcenmc03_6059"
FT   gene            complement(43330..43761)
FT                   /db_xref="GeneID:6125035"
FT                   /locus_tag="Bcenmc03_6060"
FT   CDS_pept        complement(43330..43761)
FT                   /locus_tag="Bcenmc03_6060"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bvi:Bcep1808_5724 CBS domain containing protein"
FT                   /db_xref="GI:170734562"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:6125035"
FT                   /translation="MHRVNEIMSQDVVRIAPTDSIRHAAQLMERYDIGALPVCDNNRLV
FT                   GMVTDRDLAVRAISAGKPPETRIHEVASGPIEWCFDDDSLDEIQHYMADAQLRRLPVVD
FT                   HDKRLVGMLSLADIATRTASPERDDVANTLEGVSQPKQT"
FT                   /protein_id="YP_001773676.1"
FT   misc_feature    complement(43408..43752)
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="Bcenmc03_6060"
FT   misc_feature    complement(43399..43734)
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_9; cd04622"
FT                   /db_xref="CDD:73121"
FT                   /locus_tag="Bcenmc03_6060"
FT   gene            complement(43858..44112)
FT                   /db_xref="GeneID:6125036"
FT                   /locus_tag="Bcenmc03_6061"
FT   CDS_pept        complement(43858..44112)
FT                   /locus_tag="Bcenmc03_6061"
FT                   /gene_family="HOG000268322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5620 hypothetical protein"
FT                   /db_xref="GI:170734563"
FT                   /db_xref="GeneID:6125036"
FT                   /translation="MKDSTRHGHDAPAHERQPDPQPPLKDQDRTHTRHSERHIDKQLED
FT                   TFPASDPPATGGVTRIEPDTPPGKHDGGPAEDNRKRDEK"
FT                   /protein_id="YP_001773677.1"
FT   gene            44283..44585
FT                   /db_xref="GeneID:6125037"
FT                   /locus_tag="Bcenmc03_6062"
FT   CDS_pept        44283..44585
FT                   /locus_tag="Bcenmc03_6062"
FT                   /gene_family="HOG000188022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5619 hypothetical protein"
FT                   /db_xref="GI:170734564"
FT                   /db_xref="GeneID:6125037"
FT                   /translation="MIPKRRPGVRYEINVCGGGFDSVKSHFDTWKHEPLIYRPERRMFE
FT                   GKADVRPLGDETFGATEPARFALQRACEPSDPYALAARVRDDGRELWLVMAAYDA"
FT                   /protein_id="YP_001773678.1"
FT   gene            44785..45033
FT                   /db_xref="GeneID:6125038"
FT                   /locus_tag="Bcenmc03_6063"
FT   CDS_pept        44785..45033
FT                   /locus_tag="Bcenmc03_6063"
FT                   /gene_family="HOG000268333" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmu:Bmul_5468 hypothetical protein"
FT                   /db_xref="GI:170734565"
FT                   /db_xref="GeneID:6125038"
FT                   /translation="MPMKHKPAQWLQRPEPPFPDIEPDPEPPDPDDLPPDLPEPYREPE
FT                   GDPPGHAPPERDPPSREPPVRAWRVGAPPLMRMEGVR"
FT                   /protein_id="YP_001773679.1"
FT   gene            45030..45341
FT                   /db_xref="GeneID:6125039"
FT                   /locus_tag="Bcenmc03_6064"
FT   CDS_pept        45030..45341
FT                   /locus_tag="Bcenmc03_6064"
FT                   /gene_family="HOG000188133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5618 hypothetical protein"
FT                   /db_xref="GI:170734566"
FT                   /db_xref="GeneID:6125039"
FT                   /translation="MSIRVKPGMLRDIAETLGRHFEARAMPFHVEEQPAGALHIGFRVD
FT                   GHPASLTVTFDADAFAALERADVDRQRGTLTRVAAEFDTMMARRAPTAYAGDFHFNRL"
FT                   /protein_id="YP_001773680.1"
FT   gene            45390..45704
FT                   /db_xref="GeneID:6125040"
FT                   /locus_tag="Bcenmc03_6065"
FT   CDS_pept        45390..45704
FT                   /locus_tag="Bcenmc03_6065"
FT                   /gene_family="HOG000263150" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5617 hypothetical protein"
FT                   /db_xref="GI:170734567"
FT                   /db_xref="GeneID:6125040"
FT                   /translation="MNTIQTIRVGACAFAAACALGACTQPTNGPYGTRGAPPAPPDGRG
FT                   AQSTTTMPDANTRYDPRPSPGNTMPPDTRVDVPVDVPPPGPNGAQGDQPLPGTPPPMQY
FT                   "
FT                   /protein_id="YP_001773681.1"
FT   gene            45779..46237
FT                   /db_xref="GeneID:6125041"
FT                   /locus_tag="Bcenmc03_6066"
FT   CDS_pept        45779..46237
FT                   /locus_tag="Bcenmc03_6066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   bmu:Bmul_5471 protein of unknown function DUF892"
FT                   /db_xref="GI:170734568"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="GeneID:6125041"
FT                   /translation="MANQHEHLDDWLRDAYAMERQAETMIDAQMKRVGHYPQLQDRLRL
FT                   HLDDTLGQQALVEACLMRLGTSPSATKDLAARIAAYGEIASGMLADDEVVKTVLAAYAF
FT                   EQLQIAPRTPRSSRRRRRPAKQRFARVASGFSSRSATWPRGCCAICPS"
FT                   /protein_id="YP_001773682.1"
FT   misc_feature    45791..>46105
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:185872"
FT                   /locus_tag="Bcenmc03_6066"
FT   gene            46523..47956
FT                   /db_xref="GeneID:6125042"
FT                   /locus_tag="Bcenmc03_6067"
FT   CDS_pept        46523..47956
FT                   /locus_tag="Bcenmc03_6067"
FT                   /gene_family="HOG000071905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /transl_table="11"
FT                   /note="sigma factors are initiation factors that promote
FT                   the attachment of RNA polymerase to specific initiation
FT                   sites and are then released; sigma 54 factor is responsible
FT                   for the expression of enzymes involved in nitrogen
FT                   assimilation and metabolism; the rhizobia often have 2
FT                   copies of this sigma factor; in Rhizobium etli RpoN1 shown
FT                   to be involved in the assimilation of several nitrogen and
FT                   carbon sources during free-living aerobic growth and RpoN2
FT                   is involved in symbiotic nitrogen fixation; in
FT                   Bradyrhizobium both RpoN1 and N2 are functional in
FT                   free-living and symbiotic conditions, rpoN1 gene was
FT                   regulated in response to oxygen"
FT                   /db_xref="GI:170734569"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="GeneID:6125042"
FT                   /translation="MPVSLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDMNP
FT                   FLEDGQGDEDTAAGTPEQPTEAAAPEAAPEHDDIRPPDGEVPFTAAPAPRGTSRQGDDT
FT                   DGLSPGEWIAAEPSLHQQLHDALRLYPLNKRDREAARLVIDALDDDGYLRQELPELLVA
FT                   ADPAWLLSEQDLSVALRLVQMLDRPGIAARSLSECLVLQLDAIPAGTPALAEAKAIARE
FT                   HLERLARRETAEIQRRLGCNQQTLHAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQV
FT                   RDEWIVTINPAVLPRARLHERYATLFAQSSGERDSPLGQQLQEARWLIRNVQKRFDTIQ
FT                   RVGECIVARQRDFFRYGEIAMKPLVLRDIAEELDLHESTVSRATGNKYMATPHGTFEFK
FT                   HFFPRKLEAAGKGVCSASAAKVLIRDMIAAERQTDPLSDVALAENLAGRGILLARRTVT
FT                   KYRQAMKIPPADLRRRDAA"
FT                   /protein_id="YP_001773683.1"
FT   misc_feature    46523..47947
FT                   /note="RNA polymerase factor sigma-54; Provisional; Region:
FT                   PRK12469"
FT                   /db_xref="CDD:183544"
FT                   /locus_tag="Bcenmc03_6067"
FT   misc_feature    46829..47434
FT                   /note="Sigma-54 factor, core binding domain; Region:
FT                   Sigma54_CBD; pfam04963"
FT                   /db_xref="CDD:147239"
FT                   /locus_tag="Bcenmc03_6067"
FT   misc_feature    47474..47944
FT                   /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
FT                   pfam04552"
FT                   /db_xref="CDD:113327"
FT                   /locus_tag="Bcenmc03_6067"
FT   gene            48029..48217
FT                   /db_xref="GeneID:6125043"
FT                   /locus_tag="Bcenmc03_6068"
FT   CDS_pept        48029..48217
FT                   /locus_tag="Bcenmc03_6068"
FT                   /gene_family="HOG000268355" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5730 hypothetical protein"
FT                   /db_xref="GI:170734570"
FT                   /db_xref="GeneID:6125043"
FT                   /translation="MPAKSQAQQRAAGAALSAKRGDTKMKDLKPPSKSMAKSMSEKELE
FT                   KMASTPTHGKPKHKHDA"
FT                   /protein_id="YP_001773684.1"
FT   gene            48264..48425
FT                   /db_xref="GeneID:6125044"
FT                   /locus_tag="Bcenmc03_6069"
FT   CDS_pept        48264..48425
FT                   /locus_tag="Bcenmc03_6069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   bam:Bamb_5614 protein of unknown function DUF1328"
FT                   /db_xref="GI:170734571"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="GeneID:6125044"
FT                   /translation="MLRYAIIFFIIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVT
FT                   LLLGVVRR"
FT                   /protein_id="YP_001773685.1"
FT   gene            48422..48808
FT                   /db_xref="GeneID:6125045"
FT                   /locus_tag="Bcenmc03_6070"
FT   CDS_pept        48422..48808
FT                   /locus_tag="Bcenmc03_6070"
FT                   /gene_family="HOG000268366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7022 hypothetical protein"
FT                   /db_xref="GI:170734572"
FT                   /db_xref="GeneID:6125045"
FT                   /translation="MTVMPDRSQRVAELEHALAISFPSQSTVVVHADDASGRLTINVSW
FT                   VRVPSDEDAREWRCSVDMRFDADVIERYATLDTADRLRVRTQLCDRARRAVDEHKPRVE
FT                   DAAIECNVALDVTAVVFDAALRAP"
FT                   /protein_id="YP_001773686.1"
FT   misc_feature    48449..48793
FT                   /note="Protein of unknown function (DUF3022); Region:
FT                   DUF3022; pfam11226"
FT                   /db_xref="CDD:151668"
FT                   /locus_tag="Bcenmc03_6070"
FT   gene            48936..51050
FT                   /db_xref="GeneID:6125046"
FT                   /locus_tag="Bcenmc03_6071"